Library

feed icon rss

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
  • 1
    ISSN: 0006-3525
    Keywords: Chemistry ; Polymer and Materials Science
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Notes: The signal sequence of a nuclear-directed protein encodes the necessary information for targeting the attached proteins to the cell nucleus. The sequence/structural requirements for a functional transport signal were explored with a series of peptides derived from the simian virus 40 large T-antigen nuclear signal 126-134 (CPKKKRKVED-NH2, wild type) conjugated to bovine serum albumin (BSA) through an N-terminal Cys (1) with m-maleimidobenzoyl-N-hydroxysuccinimide ester. Nuclear accumulation was virtually complete 15 min after microinjection into green monkey kidney cells (TC-7). Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA. The Orn peptide and the 34-residue wild-type analogue conjugated to BSA also transported to the nucleus but at a slower rate than 1. The reverse wild-type, Asn- and Gln-BSA conjugates of these signal analogues did not show transport to the nucleus after 6 h of incubation. In an effort to learn if such signal sequences would also target a small molecule such as a fluorescent tag to the nucleus, 1 fluorescently tagged with monobromobimane was prepared and microinjected into TC-7 cells. The peptide was distributed throughout the cell. These results support the notion that a positively charged residue at position 128 is needed for rapid nuclear transport and that the intracellular transport machinery has spatial recognition. The results with fluorophore-peptide conjugates suggest nuclear localization of these low molecular weight peptides will be difficult to attain even if attached to a functional nuclear localization sequence.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 2
    Electronic Resource
    Electronic Resource
    New York : Wiley-Blackwell
    Biopolymers 34 (1994), S. 171-175 
    ISSN: 0006-3525
    Keywords: Chemistry ; Polymer and Materials Science
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Notes: One-dimensional nmr exchange spectroscopy was carried out to determine thermodynamic parameters of cyclophilin-induced cis-trans isomerization of succinyl-Ala-Phe-Pro-Phe-p-nitroanilide. Rate measurements were possible at physiological temperatures. The kc/Km of rat cyclophilin was found to he 12.8 (±0.5) s-1 μM-1 at 37°C, intermediate to previously reported values that used a coupled enzyme assay extrapolated to this temperature. Activation energies (ΔG≠) for the uncatalyzed and catalyzed reaction at 37°C were found to be 19.7 and 17.1 kcal/mol, respectively, and were primarily due to an enthalpic barrier. © 1994 John Wiley & Sons, Inc.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 3
    ISSN: 0009-2940
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Proton Resonance Spectroscopy of Unsaturated Ringsystems, XXX. Benzo[c]-1,7-methano[12]annulene and Its DianionThe 400-MHz 1H NMR spectra of benzo[c]-1,7-methano[12]annulene (1) and its dianion have been analyzed in terms of chemical shifts and H,H spin-spin coupling constants using two-dimensional methods and iterative calculations. Bond orders and CC bond lengths have been estimated from the 3J values and the effect of benzoannulation on the paratropic and diatropic behaviour of 1 and 12-, respectively, is derived from the chemical shifts in comparison with those obtained for the parent systems 1,7-methano[12]annulene (2) and its dianion (22-). In the hydrocarbon, paratropism is reduced by approx. 40-50%, while in the dianion the reduction of diatropism amounts to approx. 10%. The Q value of both systems is characteristic of week [4n]-π-character for 2 and strong [4n + 2]-π-character for 22-. In addition, the results of the 1H NMR analysis of 9,10-dimethyl 1,7-methano[12]annulene-9,10-dicarboxylate (3) are given and discussed with respect to the structure of this compound. The bond fixation present in 3 differs from that in the benzo-annulated systems.
    Notes: Die 400-MHz-1H-NMR-Spektren von Benzo[c]-1,7-methano[12]annulen (1) und seinem Dianion wurden hinsichtlich chemischer Verschiebungen und H,H-Spin-Spin-Kopplungskonstanten mit Hilfe zweidimensionaler Methoden und iterativer Berechnungen analysiert. Bindungsordnungen und CC-Bindungslängen wurden auf der Basis der 3J-Werte abgeschätzt. Der Effekt der Benzoanellierung für die paratropen bzw. diatropen Eigenschaften von 1 bzw. 12- ergibt sich durch einen Vergleich der chemischen Verschiebungen mit denen der Stammsysteme 1,7-Methano[12]annulen (2) und seinem Dianion (22-). Im Kohlenwasserstoff ist der paratrope Charakter um ca. 40-50% reduziert, während die Reduktion des diamagnetischen Verhaltens im Dianion ca. 10% beträgt. Der Q-Wert für beide Systeme ist charakteristisch für schwachen [4n]-π-Charakter in 2 und starken [4n + 2]-π-Charakter in 22-. Zusätzlich werden die Ergebnisse der Analyse des 1H-NMR-Spektrums von 9,10-Di-methyl-1,7-methano[12]annulen-9,10-dicarboxylat (3) angegeben und im Hinblick auf die Struktur der Verbindung diskutiert. Die in 3 vorliegende Bindungsfixierung weicht von der in den benzoanellierten Systemen ab.
    Additional Material: 9 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 4
    ISSN: 0025-116X
    Keywords: Chemistry ; Polymer and Materials Science
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology , Physics
    Notes: The relative affinity of various mono and difunctional sulfoxides for lithium picrate in toluene was investigated by a competition method utilizing immobilized linear polyethers (glymes). In general, the difunctional sulfoxides were found to bind more strongly than the monofunctional sulfoxides. However, difunctional ligands which would result in eight-membered ring chelated structures bound lithium ion more strongly than those which would result in six-membered ring chelated structures.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 5
    Electronic Resource
    Electronic Resource
    New York : Wiley-Blackwell
    Die Makromolekulare Chemie 188 (1987), S. 135-148 
    ISSN: 0025-116X
    Keywords: Chemistry ; Polymer and Materials Science
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology , Physics
    Notes: Detailed 13C NMR chemical shift rules are devised for ethylene and propylene polymers and for low-molecular-weight analogs. The rules are additive and account for substituent effects as well as for configurational sequences. The agreement between the observed and the predicted shifts is excellent. A computer program has been written to obtain the predicted shifts quickly and with minimum effort.
    Additional Material: 7 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 6
    Electronic Resource
    Electronic Resource
    New York : Wiley-Blackwell
    Die Makromolekulare Chemie 188 (1987), S. 2665-2677 
    ISSN: 0025-116X
    Keywords: Chemistry ; Polymer and Materials Science
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology , Physics
    Notes: A general treatment is devised for the 13C NMR spectral analysis of copolymers involving ethene and propene. The basis of the method is the computerized “synthetic approach” proposed earlier (Anal. Chem.) 56, 2320 (1984) and entails the use of first-order Markovian statistics, Monte Carlo polymer chain generation, spectral prediction, and spectral simulation. By this means, copolymer and homopolymer spectra of increasing complexity are readily simulated. The method is shown to accommodate all structural types (viz. stereosequences, regiosequences, and polymer chain ends) and provides good results for atactic poly(propylene), irregular poly(propylene), isotactic ethene/propene copolymers, ethene/propene rubbers, and ethene/propene oils.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 7
    ISSN: 0269-3879
    Keywords: Chemistry ; Analytical Chemistry and Spectroscopy
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 8
    ISSN: 0269-3879
    Keywords: Chemistry ; Analytical Chemistry and Spectroscopy
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Medicine
    Notes: A high-performance liquid chromatographic assay is described for the separation and quantification of nadolol isomers in human plasma. The isomers were quantified using reverse-phase HPLC and fluorometric detection after derivatization with the chiral reagent R(-)-1-(naphthyl)ethylisocyanate [R(-)-NEI]. The N-isopropyl analogue (one isomer) of nadolol was used as the internal standard. The method was reproducible based on precision studies where the percent relative standard deviation was less than 15%. The lower limit of quantitation for each isomer was 2.5 ng/mL. This method was used to evaluate the pharmacokinetic profile of nadolol isomers in human subjects following both single and multiple oral dosing.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 9
    Electronic Resource
    Electronic Resource
    Stamford, Conn. [u.a.] : Wiley-Blackwell
    Polymer Engineering and Science 30 (1990), S. 571-576 
    ISSN: 0032-3888
    Keywords: Chemistry ; Chemical Engineering
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology , Mechanical Engineering, Materials Science, Production Engineering, Mining and Metallurgy, Traffic Engineering, Precision Mechanics , Physics
    Notes: In a plasticating extruder, solid polymers are heated and are subjected to high pressures before they are melted and delivered to a die. In both the solids conveying and melting sections, these temperature and pressure increases will compact the unmelted polymer bed as it moves down the screw channel. Performance of the extruder depends in part on how well the screw design matches the compaction behavior of the resin for a given set of process conditions. The design of these screw sections, however, is often done based on past experience and with little knowledge of the resin compaction behavior. A much improved design would include screw performance prediction using variable bulk density and computer simulations. Computer simulations, however, are often performed using constant solid bulk density because of the lack of reliable density data as a function of both pressure and temperature. An instrument was developed for studying the compaction behavior of pellet and powder resins. Bulk densities and storage friction coefficients are reported for several important thermoplastic resins as a function of temperature and pressure. The bulk density data were fitted to a semi-empirical model.
    Additional Material: 9 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 10
    Electronic Resource
    Electronic Resource
    New York, NY [u.a.] : Wiley-Blackwell
    Journal of Applied Polymer Science 37 (1989), S. 695-705 
    ISSN: 0021-8995
    Keywords: Chemistry ; Polymer and Materials Science
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology , Mechanical Engineering, Materials Science, Production Engineering, Mining and Metallurgy, Traffic Engineering, Precision Mechanics , Physics
    Notes: A technique for determining radiation chemical yields from lithographic exposure curves for crosslinking type negative electron beam resists has been extended to include polymers with a general Poisson distribution. The technique is applied to several different chlorine-containing styrene-based resists. The radiation yields show good agreement with the differences in lithographic sensitivity and are explained by recent mechanistic studies. Optimal synthetic approaches for preparing this type of resist are described.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...