Library

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • 1960-1964  (1,061)
  • 1890-1899
  • 1840-1849
  • 1961  (1,061)
  • Inorganic Chemistry  (739)
  • Life and Medical Sciences  (322)
Material
Years
  • 1960-1964  (1,061)
  • 1890-1899
  • 1840-1849
Year
Keywords
  • 1
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 108 (1961) 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 2
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 108 (1961) 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 3
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 4
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 108 (1961), S. 107-129 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 5
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 6
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 7
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 108 (1961), S. 63-93 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 27 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 8
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 108 (1961), S. 131-143 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 9
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 108 (1961) 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 10
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 108 (1961), S. 95-106 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 11
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 108 (1961), S. 193-201 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 12
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 108 (1961), S. 287-309 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 13
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961) 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 14
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 15
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 16
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 17
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961), S. 1-17 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 16 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 18
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961), S. 19-36 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 14 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 19
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961), S. 37-55 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 20
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961), S. 57-71 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 21
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961) 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 22
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961), S. 93-113 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 2 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 23
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961), S. 73-92 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 24
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 25
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961), S. 151-157 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 26
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961), S. 141-149 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 12 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 27
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 28
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961), S. 173-197 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 29
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961), S. 199-217 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 30
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961) 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 31
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 32
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961), S. 237-249 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 10 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 33
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 34
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961), S. 279-287 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 8 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 35
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 36
    Electronic Resource
    Electronic Resource
    New York, NY : Wiley-Blackwell
    Journal of Morphology 109 (1961), S. 323-349 
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 37
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 38
    ISSN: 0362-2525
    Keywords: Life and Medical Sciences ; Cell & Developmental Biology
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Biology , Medicine
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 39
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 233-233 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 40
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 1-2 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 41
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 13-22 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The conditions for preparing AlB2 from Al and B have been investigated. In all experiments at 800°C, a boron phase, containing small amounts of Al, was formed as a by-product of AlB2. The formation of AlB2 depends mainly from the degree of dispersion of the reaction components. Above 980°, AlB2 decomposes into Al and β-AlB2. The conditions for crystallising AlB2-sheets from molten Al, containing E, have been examined.
    Notes: Die Darstellungsbedingungen für AlB2 aus Al und B werden eingehend untersucht. Bei ∼800 °C bildet ein kleiner Teil des Bors stets eine aluminiumarme Phase, die neben dem AlB2 anfällt. Der Umsetzungsgrad zu AlB2 hängt vor allem von dem Verteilungsgrad der Reaktionskomponenten ab. Oberhalb 980° zerfällt AlB2 in Al und β-AlB12. Weiterhin wurden die Bedingungen für die Bildung blättchenförmiger AlB2-Kristalle aus borhaltigen Aluminiumschmelzen nachgeprüft.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 42
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 43
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 113-119 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Various mixtures of phosphorus trichloride and triethyl phosphite on one side and triphenyl phosphite and tris-diethylamino phosphine on the other side were prepared to study the equilibria resulting from reorganization in both systems. The equilibrium constants are compared with values calculated on the basis of completely random reorganization. It is shown that the mixed compounds of both systems are more stable than would be expected from statistical calculations.
    Notes: Es wurden Mischungen von Phosphortrichlorid und Triäthylphosphit einerseits und Triphenylphosphit und tris-Diäthylaminophosphin andererseits hergestellt und die sich in diesen beiden Systemen durch Ligandenaustausch einstellenden Gleichgewichte untersucht. Die Gleichgewichtskonstanten der Systeme werden mit denen verglichen, die sich bei rein statistisch-zufälliger Verteilung der Liganden ergeben würden. Es wurde gezeigt, daß die Verbindungen mit verschiedenen Liganden in beiden untersuchten Systemen eine größere Stabilität aufweisen, als man nach der Statistik erwarten würde.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 44
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 123-136 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By diffusion annealing of the solid metals Mg and Zr at 614°C and by interaction between liquid Mg and compact Zr, following phases have been obtained: α-mixed-crystal, intermetallic phase δ with a homogeneity range from about 60 to 70% Zr, and α-Zr-mixedcrystal (solid solution of Mg in α-Zr) with a content of Mg up to 15% Mg at 800°C.Several alloys with contents of Zr from about 54 to 85% have been prepared by powder metallurgy. There is a maximum of Brinell hardness at 50-70% Zr.Preliminary annealing experiments have been made in the system Mg—Zn—Zr.
    Notes: Bei Diffusionsglühungen der festen Metalle bei 614°C und von flüssigem Mg mit kompaktem Zr bei 800°C entstehen im Diffusionsgefüge folgende Phasen: α-Mischkristall, intermetallische Phase δ mit Homogenitätsbereich von zunächst ungefähr 60 bis 70% Zr und α-Zr-Mischkristall (feste Lösung von Mg in α-Zr) mit möglicherweise bis zu 15% Mg bei 800°C.Nach der pulvermetallurgischen Methode wurden eine Reihe von Legierungen mit 54-85% Zr hergestellt. Auf der Mg-Seite wurden diese durch Legierungen aus Mg-Schmelzen mit Zr-Zusatz ergänzt. Brinellhärtemessungen lieferten eine Härte-Konzentrationskurve, die zwischen ungefähr 50 und 70% ein ausgeprägtes Maximum aufwies. Dies sowie Debye-Scherrer-Aufnahmen und die mikroskopische Untersuchung der Legierungen bestätigten das Vorhandensein Zr-reicher Phasen zwischen ∽50 und 70% und etwa 85 bis 100% Zr.Im System Mg—Zn—Zr wurden orientierende Diffusionsglühungen angestellt.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 45
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 137-144 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: CsCl and CoCl2 form a fourfold eutectical system with the compounds Cs3CoCl5, Cs2CoCl4 and CsCoCl3. Two other compounds - Cs5Co2Cl9 and Cs3Co2Cl7 - decompose in the solid state.In the system RbCl/CoCl2 there are: Three eutectics, the compounds Rb2CoCl4 and RbCoCl3, further on the compound Rb3CoCl5, the melting point of which is also a peritectic. Rb2CoCl4 has a transition point.The system KCl/CoCl2 shows the congruently melting compound K2CoCl4, the incongruently melting KCoCl3 (with a transition point in the solid state), two eutectics and a peritectic.For NaCl and CoCl2 the same diagram was found as already described in literature.LiCl and CoCl2 form mixed crystals with a minimum on the LiCl-side; on the CoCl2-side there is an peritectical system. At lower temperature, a miscibility gap exists. In the space of this miscibility gap the compounds Li4CoCl6, Li2CoCl4 and LiCoCl3 are formed.The melting point of CoCl2 has been newly determined. The effects of moisture and some solvents on these compounds are described.References to the possible structures are given.
    Notes: CsCl und CoCl2 bilden ein vierfach eutektisches System mit den Verbindungen Cs3CoCl5, Cs2CoCl4 und CsCoCl3. Zwei weitere Verbindungen  -  Cs5Co2Cl9 und Cs3Co2Cl7  -  zersetzen sich im festen Zustand.Im System RbCl/CoCl2 liegen vor: Drei Eutektika, die Verbindungen Rb2CoCl4 und RbCoCl3, sowie die Verbindung Rb3CoCl5, mit deren Schmelzpunkt ein Peritektikum zusammenfällt. Rb2CoCl4 besitzt einen Umwandlungspunkt.Aus KCl und CoCl2 bilden sich das kongruent schmelzende K2CoCl4 und das inkongruent schmelzende KCoCl3, das noch einen Umwandlungspunkt besitzt. Dazu gehören zwei Eutektika und das Peritektikum.Das schon beschriebene Diagramm des Systems NaCl/CoCl2 konnte bestätigt werden.Zwischen LiCl und CoCl2 herrscht auf der LiCl-reichen Seite Mischkristallbildung mit Minimum, die dann auf der CoCl2-reichen Seite in ein Peritektikum übergeht. In der Mischungslücke bilden sich bei tieferen Temperaturen die Verbindungen Li4CoCl6, Li2CoCl4 und LiCoCl3.Der Schmelzpunkt des CoCl2 wurde neu bestimmt.Das Verhalten der Verbindungen gegen Feuchtigkeit und einige Lösungsmittel wird beschrieben. Hinweise über die möglichen Strukturen werden gegeben.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 46
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 163-173 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Nb3O7Cl is formed by thermal interaction (600°C) between Nb2O5 and NbOCl3 as colourless single crystals (in the presence of O2 or Cl2) or as blue crystals (in the absence of any oxidizing agents). It is thermally transportable according to the heterogeneous equilibrium \documentclass{article}\pagestyle{empty}\begin{document}$$ {\rm NbOCl}_{{\rm (s)}} + 4{\rm NbCl}_{{\rm 5(g)}} \mathbin{\lower.3ex\hbox{$\buildrel\textstyle\rightarrow\over{\smash{\leftarrow}\vphantom{_{\vbox to.5ex{\vss}}}}$}} 7{\rm NbCl}_{{\rm 3(g)}}. $$\end{document}NbOCl2 results from the reduction of NbOCl3 by H2 or from the interaction between Nb, NbCl5 and Nb2O5 in a sealed tube at 370/350°C; there is a transport reaction according to \documentclass{article}\pagestyle{empty}\begin{document}$$ {\rm NbOCl}_{{\rm 2(s)}} + {\rm NbCl}_{{\rm 5(g)}} \mathbin{\lower.3ex\hbox{$\buildrel\textstyle\rightarrow\over{\smash{\leftarrow}\vphantom{_{\vbox to.5ex{\vss}}}}$}} {\rm NbOCl}_{{\rm 3(g)}} + {\rm NbCl}_{{\rm 4(g)}}. $$\end{document}At analogous conditions, the diamagnetic compound TaOCl2 has been prepared by the transport reactions between SiO2, Ta and TaCl5 or Ta2O5, Ta and TaCl5.
    Notes: Nb3O7Cl wurde durch Erhitzen (600°C) von Nb2O5 mit einem NbOCl3-Überschuß hergestellt. In Gegenwart von O2 oder Cl2 erhält man farblose Einkristalle. Wird ohne Zugabe von Oxydationsmitteln gearbeitet, so entstehen blaue Kristalle der gleichen Verbindung. Sie besitzt somit ein Homogenitätsgebiet. Nb3O7Cl ist mit Hilfe des heterogenen Gleichgewichts Nb3O7Cl + 4 NbCl5g = 7 NbOCl3g im Temperaturgefälle transportierbar.NbOCl2 entsteht bei der Reduktion von NbOCl3 mit 2. Zu seiner Darstellung setzt man am besten Nb, NbCl5 und Nb2O5 und Nb2O5 bei 370/350°C im Einschlußrohr um. Man kann die Synthese mit dem Transport im Temperaturgefälle verbinden, der nach der Gleichung NbOCl2 + NbCl5g = NbOCl3g + NbCl4g vor sich geht.TaOCl2 konnte durch Umsetzung von SiO2, Ta und TaCl5 oder von Ta2O5, Ta und TaCl5 im Einschlußrohr gewonnen werden. Die Verbindung erwies sich als dem NbOCl2 in vieler Hinsicht ähnlich und konnte auch auf die analoge Weise im Temperaturgefälle transportiert werden. TaOCl2 ist diamagnetisch.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 47
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 202-204 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Beim Erhitzen von Zr und Te bzw. aus ZrO2 und Te entsteht unter Luftzutritt bei 750°C die Verbindung ZrO2 · 2 TeO, die röntgenographisch untersucht wurde.
    Notes: By heating Zr and Te or ZrO2 and Te in air at 750°C the compound ZrO2 · 2 TeO results. The crystal parameters have been determined.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 48
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 187-201 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The conversion of normal kaolinite into H-kaolinite by means of dilute acids, organic cation exchangers, and electrodialysis has been studied.By interaction between kaolinite and an acid exchange resin, a H-kaolinite has been prepared; 90% of its exchange sites were occupied by H- and Al-ions. The nature of the Al-exchange has been investigated.Similarly, the preparation of a H-montmorillonite and its inner-crystalline swelling were studied.
    Notes: Die verschiedenen Verfahren zur Belegung von Tonmineralen mit austauschfähigen Wasserstoffionen wurden miteinander verglichen. An den durch Behandeln eines Kaolinits mit sehr verdünnten Säuren. mit einem organischen Kationenaustauscher und durch Elektrodialyse hergestellten H-Kaoliniten wurde das Verhalten der neben den austauschfähigen H-Ionen stets vorhandenen austauschfähigen Al-Ionen studiert.Als wirksamstes und schonendstes Verfahren erwies sich die Behandlung mit einem stark sauren organischen Kationenaustauscher. Nach diesem Verfahren wurde eine größere Menge H-Kaolinit hergestellt, die bei nur unbedeutendem Angriff auf das Kaolinitgitter zu 90% (H + Al)-Ionen enthielt und sich für die Untersuchung der charakteristischen Eigenschaften des H-Kaolinits geeignet erwies.Es gelang, nach dem gleichen Verfahren einen Montmorillonit mit Wasserstoffionen zu belegen. Die innerkristalline Quellung dieses H-Montmorillonits wurde röntgenographisch untersucht.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 49
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 208-218 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Several alkali periodato- and tellurato-cuprates(III) have been prepared at definite values of pH. Their chemical and physicochemical properties (solubilities, thermal stabilities, magnetic behaviours) are communicated.
    Notes: Durch Regulation der Wasserstoffionenkonzentration ist es möglich, die bisher nicht dargestellten Komplexe des dreiwertigen Kupfers zu isolieren. Die isolierten kristallinischen Komplexe wurden durch chemische Analyse und Röntgen-Pulverdiagramme charakterisiert; außerdem wurde ihre Löslichkeit, thermische Stabilität und magnetische Suszeptibilität bestimmt.
    Additional Material: 8 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 50
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 226-228 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Mitteilung der Raumgruppe und Dimensionen der Elementarzelle von Mangan(II)-sulfat-monohydrat.
    Notes: Manganese(II) sulphate monohydrate is monoclinic prismatic with space group A 2/a—C2h6 and the cell-dimensions are a = 7.758 ± 0.008 Å, b = 7.612 ± 0.008 Å, c = 7.126 ± 0.008 Å, β = 115° 421/2′ ± 2′. The unit cell contains (MnSO4 · H2O)4 and the calculated density at 25°C is 2.960 g./cm3.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 51
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 52
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 234-234 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 53
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 265-275 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The dissociation properties of mono- and dicacodylatochromium(III) complexes in aqueous solutions have been investigated by physico-chemical methods.Coupled with an acid dissociation, there is a secondary complex dissociation yielding free cacodylic acid and basic chromium(III) complexes.
    Notes: Mit Hilfe physikalisch-chemischer Verfahren werden ein Mono- sowie ein Dikakodylatokomplex des dreiwertigen Chroms nachgewiesen und deren Verhalten in wäßriger Lösung untersucht. Hierbei wird vor allem eine mit einer Säuredissoziation gekoppelte sekundäre Komplexdissoziation festgestellt, die einerseits zur Abspaltung freier Kakodylsäure, andererseits zur Bildung basischer Chrom(III)-komplexe führt.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 54
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 290-303 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Arsenic acid esters react with HF or AsF3 forming esters of monomeric fluoroarsenic acids. These are only stable as addition compounds with one mole of alcohol, e. g. FAsOH-(OR)3, exhibiting the coordination number 5. In polar solvents, a rearrangement to heteropolar compounds with both the coördination numbers 4 and 6, e. g. [AsOH(OR)3]- [AsOH(OR)3F2]-, produced by transference of fluorine, occurs.
    Notes: Monomere Fluoroarsensäureester entstehen aus Arsensäureestern durch Reaktion mit HF oder mit AsF3. Sie sind nicht in der Form FAsO(OR)2 bzw. F2AsO(OR) mit Koordinationszahl 4 am Arsen beständig, sondern erst nach Anlagerung eines Mols Alkohol, wobei die Koordinationszahl 5 ausgebildet wird, z. B. FAsOH(OR)3. In dieser Form lösen sich die Ester in unpolaren Lösungsmitteln, wobei schon bei verhältnismäßig niedriger Konzentration eine Aggregation eintritt. In polaren Lösungsmitteln lösen sie sich als heteropolare Verbindungen, wobei Kationen mit Koordinationszahl 4, Anionen mit Koordinationszahl 6 ausgebildet werden, z. B. [AsOH(OR)3][AsOH(OR)3F2]; bei der Umlagerung in die heteropolare Form erfolgt stets die Übertragung des Fluors und nicht die der anderen Gruppen.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 55
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 328-344 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: From the IR-spectra of gaseous NSF3 and SNF, an assignment of the fundamental vibrations and an estimation of the valence force constants are given.The constitutions of SNF, NSF3, S3N3F3, and S4N4F4 are investigated by NMR-spectra.
    Notes: Es wird versucht, aus den Infrarotspektren der Gase NSF3 und SNF die Struktur der Molekeln abzuleiten. Eine Zuordnung der Grundschwingungen wird vorgenommen und die Berechnung der Valenzkraftkonstanten durchgeführt. [NSF3: fSN = 12,4 msyn/Å (SN-Bindungsgrad = 2,7), fSF = 5,(6) msyn/Å (SF-Bindungsgrad = 1,(2)); SNF: fSN = 10,4 msyn/Å (SN-Bindungsgrad = 2,3) fNF = 1,(5) msyn/Å]. Mittels der KMR-Spektren von SNF, NSF3, S3N3F3 und S4N4F4 werden ebenfalls Aussagen über die Konstitutionen dieser Verbindungen erhalten.
    Additional Material: 10 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 56
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 3-12 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The dipole moments of the compounds N(CH3)2Cl, N(C2H5)2Cl, N(CH3)Cl2, and N(C2H5)Cl2 were determined and the order of magnitude of the NCl3-moment was ascertained. The variations of the N—Cl-binding- and N—CH3-group moments within the series N(CH3)3/N(CH3)2Cl/N(CH3)Cl2/NCl3 resulting from inner molecular induction were estimated for the (+)N—Cl(-) and (-)N—Cl(+) cases. A comparison with the order of magnitude in the corresponding variations of the C—Cl-binding- and C—CH3,-group moments in the alkyl halogenides led to the result that the direction of the N—Cl-binding moment in the compounds investigated is as shown: (+)N—Cl(-).
    Notes: Die Dipolmomente der Verbindungen N(CH3)2Cl, N(C2H5)2Cl, N(CH3)Cl2 und N(C2H5)Cl2 wurden bestimmt und das des Chlorstickstoffs der Größenordnung nach ermittelt. Die Änderungen der N—Cl-Bindungs- und N—CH3-Gruppenmomente innerhalb der Reihe N(CH3)3/N(CH3)2Cl/N(CH3)Cl2/NCl3 infolge innermolekularer Induktion wurden für die Fälle (+)N—Cl(-) und (-) und (-)N—Cl(+) abgeschätzt. Ein Vergleich mit der Größenordnung entsprechender Änderungen der C—Cl-Bindungs- und C—CH3-Gruppenmomente bei Alkylhalogeniden führt zu dem Ergebnis, daß der Richtungssinn des N—Cl-Bindungsmoments in den untersuchten Verbindungen (+)N—Cl(-) ist.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 57
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The reactions of the LEWIS acid SO3, with tertiary phenyl and cyclohexyl derivatives of N, P, As, Sb, and Bi have been studied. According to the sequence: phosphine, bismuthine, arsine, and stibine, especially stable SO3-adducts are formed by the compounds of P and surprisingly of Bi. In the case of As- and Sb-compounds redox reactions occur.Tertiary phosphine and arsine oxides and sulfides, respectively, yield SO3 -adducts, too.
    Notes: Die Reaktionen der LEWIS-Säure. SO3 mit den tertiären Phenyl- und Cyclohexylderivaten von N, P, As, Sb und Bi wurden studiert. Besonders stabile SO3-Addukte bildeten die Verbindungen des Phosphors und überraschenderweise des Wismuts. Die Donatoreigenschaften der Triphenylverbindungen nehmen in folgender Reihe ab: Phosphin, Bismutin, Arsin und Stibin. Den schwächeren LEWIS-Basen gegenüber wirkte SO3 oxydierend, wobei im Falle des Arsins auch dieser Reaktion eine Adduktbildung voran ging. Den SO3-Addukten entsprechen zum Teil stabile BH3-Addukte. Auch die tertiären Phosphin- und Arsin-Oxyde bzw. Sulfide reagierten mit SO3 unter Bildung von Addukten. Die bisher wenig bekannten Donatoreigenschaften dieser Verbindungsklasse wurden damit deutlich gemacht.
    Additional Material: 15 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 58
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 98-104 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Melting sodium oxide even reacts with gold. Crucibles of magnesium oxide only are useful to some extent, but not for thermal analysis of the system NaCl-Na2O. Therefore, the melting phenomena were studied by observing the motion of a heavy piston into the melting material while heating. By this means a eutectic point was found at ∼700 °C and ∼25 mol% Na2O; there is no evidence for the formation of any compound.
    Notes: Schmelzendes Natriumoxid reagiert sogar mit Gold. Als Gefäßmaterial ist nur Magnesiumoxid beschränkt brauchbar, aber die käuflichen Geräte sind nicht zur thermischen Analyse des Systems NaCl-Na2O geeignet. Die Schmelzerscheinungen wurden deshalb dadurch studiert, daß das Eindringen eines belasteten Stempels in das schmelzende Material beim Erhitzen verfolgt wurde. So wurde ein Eutektikum bei ∼700 °C und ∼25 Mol-% Na2O gefunden; Anzeichen für die Existenz einer Verbindung aus den Komponenten ergaben sich nicht.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 59
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 133-142 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Non-electrolytic binuclear complexes of the composition [MeX1{OC3H6N(C2H5)2}1]2 are formed by interaction between 3-N,N-diethyl aminopropanol and Cu- and Zn-halo- genides, respectively. Using 2-N,N-diethyl aminoethanthiol, Zn- and Ni-compounds of the same kind have been prepared. N,N,N′-triethyl ethylene diamine yields ordinary mono- nuclear complexes, [enCuX2], and binuclear compounds. Only mononuclear complexes of copper are formed by N,N-diethyl ethylene diamine.
    Notes: 3-N,N-diäthylaminopropanol bildet ebenso wie das entsprechende Äthanolamin mit Kupfer- bzw. Zinkhalogeniden Zweikernkomplexe [CuX1{OC3H6N(C2H5)2}1]2 von Nichtelektrolytcharakter. Vom 2-N,N-diäthylaminoäthanthiol konnten gleichartige Verbindungen nur mit Zinkhalogeniden und erstmalig auch mit Nickelsalzen erhalten werden. Das N,N,N′-Triäthyläthylendiamin führte entweder zu Einkernkomplexen [en CuX2] der üblichen Art oder bei Überschuß zu Zweikernkomplexen von anderer Zusammensetzung und Konstitution. Das N,N-Diäthyläthylendiamin verhielt sich als Ligand praktisch ebenso wie das unsubstituierte Äthylendiamin und lieferte mit Kupferhalogeniden lediglich Einkernkomplexe.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 60
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 309 (1961), S. 233-244 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: A culminative effect of some factors, which are responsible for the formation of aluminum hydroxide crystals has been observed in experiments treating alkali aluminates by CO2 and aqueous solutions of aluminum salts by alkali.The concentration of the OH-ions, the temperature of the reaction, and the kind of bond of water decide the nature of the precipitation products.The precipitated materials have been identified by X-ray diagrams, phase contrast microscopy, electron microscopy, and IR-spectroscopy.
    Notes: Fällungsversuche mit Aluminatlaugen und wäßrigen Lösungen von Aluminiumsalzen haben das Zusammenwirken einiger Faktoren, die für die Bildung kristalliner Aluminium-trihydroxide verantwortlich sind, erkennen lassen. Die OH--Ionenkonzentration, die Reaktionstemperatur und die Art der Bindung des Wassers bestimmen den Charakter des Fällungsproduktes. Die Identifizierung der ausgefällten Materialien geschah unter Verwendung des Röntgendiffraktometers, der Phasenkontrastmikroskopie, der Elektronenmikroskopie und der Infrarotspektroskopie.
    Additional Material: 5 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 61
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 309 (1961), S. 171-180 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The IR-spectra of the gaseous thionylimides OSNH and OSND and an assignment of the fundamental vibrations are communicated. The compounds have the structure 0—S—N—X with ∢OSN ≈ 120° and ∢SNX = 110° → 130°, X being probably in the OSN-plane. From the SO- and SN-valence force constants (8.7 and 8.3 mdyn/Å, respectively), SO-and SN-bond orders of 1.8 and 1.9 result.
    Notes: Die Infrarotspektren der gasförmigen Thionylimide OSNH und OSND werden mitgeteilt und eine Zuordnung der Grundschwingungen vorgenommen. Die Moleküle besitzen die Struktur O—S—N—X; ∢OSN ≈ 120°; ∢SNX = 110° → 130°; X befindet sich vermutlich in der OSN-Ebene. Ob eine cis- oder trans-Form vorliegt, kann nicht entschieden werden. Die SO- und SN-Valenzkraftkonstanten betragen 8,7 und 8,3 mdyn/Å, daraus ergeben sich die SO- und SN-Bindungsgrade zu 1,8 und 1,9.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 62
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961), S. 212-223 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The RAMAN and IR-spectra of trisulfuryl chloride are observed and discussed. The symmetries belonging to the point groups C2 h and D2 h are excluded by structure considerations. The structures C1, C2, Cs and C2 v are remaining. The stretching frequencies are assigned. It has been found that the stretching frequencies of the (sulfuroxygen)-double bond and the single bond are doubled in consequence of the central SO3 group. The known RAMAN-spectrum of disulfuryl chloride is completed by the infrared spectrum.
    Notes: Die RAMAN- und Ultrarotspektren des Trisulfurylchlorides wurden aufgenommen und diskutiert. Durch Strukturbetrachtungen werden die Symmetrien der Punktgruppen C2 h und D2 h ausgeschlossen. Offen bleiben die Strukturen C1, C2Cs und C2 v. Die Valenzfrequenzen werden zugeordnet. Es zeigt sich, daß sowohl die Zahl der Valenzfrequenzen der Schwefel - Sauerstoff-Doppelbindung als auch die der Einfachbindung infolge der mittelständigen SO3-Gruppe verdoppelt werden. - Das bekannte RAMAN-Spektrum des Disulfurylchlorides wird durch das Ultrarotspektrum ergänzt.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 63
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Experimental examinations of the theorie of d-electron vacancies of metal catalysts have shown that the influence of additive iron in Ni-catalysts is counterbalanced by small amounts of copper. Copper additions of 5% cause an alteration of the catalytic activity of about one order of magnitude.
    Notes: Versuche zur experimentellen Überprüfung der d-Lücken-Theorie der Metallkatalysatoren zeigen, daß der Einfluß von Eisenzusätzen zu Nickel-Katalysatoren durch geringe Kupfersätze aufgehoben werden kann. Kupferzusätze von 5% bewirken eine Änderung der katalytischen Aktivität um etwa eine Größenordnung.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 64
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 143-169 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Compounds of the alkali metals with copper do not exist; only lithium is somewhat soluble in metallic copper. According to literature data silver forms with lithium several intermetallic phases; the phase NaAg2, up to now unknown, was found in the system Na/Ag. Gold forms compounds with all alkali metals. The existance of the following phases could be established by means of thermal analysis: Li15Au4, Li3Au, δ1 and δ2 (∼35 At.-% Au), β′, β′1, and β′2 (between 44.5 and 51%), Li4Au5, α(60-100%), α1 (63-83%), α2 (60%); Na2Au, NaAu, NaAu2; K2Au, KAu, KAu2, KAu4; RbAu, RbAu2, RbAu4; CsAu. The structures of NaAg2, Li15Au4, β′, β′1, β′2, α and α1, furthermore of RbAu and CsAu could be elucidated.The investigated systems show clear correlations; the tendency in forming compounds increases from copper to gold and from caesium to lithium. Broader regions of homogeneity occur only in lithium-containing systems.The volume chemistry of alloys is discussed. In all solid solutions and alloys the alkali metals are strongly contacted; provided that the amount of noble metal is not too small, the “Volume increments in intermetallic compounds” according to W. Biltz can be applied to the alkali metals.
    Notes: Verbindungen der Alkalimetalle mit Kupfer existieren nicht; nur Li löst sich etwas im Cu-Metall. Silber bildet nach Literaturangaben mit Li mehrere intermetallische Phasen; im System Na/Ag wurde die bisher übersehene Phase NaAg2 gefunden. Gold bildet mit allen Alkalimetallen Verbindungen. Durch thermische Analyse wurden folgende Phasen nachgewiesen: Li15Au4, Li3Au, δ1 und δ2 (∼35 At.-% Au), β′, β′1, und β′2 (zwischen 44,5 und 51%), Li4Au5, α (60-100%), α1 (63-83%), α2 (60%). — Na2Au, NaAu, NaAu2 — K2Au, KAu, KAu2, KAu4 — RbAu, RbAu2, RbAu4, — CsAu. Die Strukturen von NaAg2, im System Li/Au von Li15Au4, β′, β′1, β′2, α und α1, ferner von RbAu und CsAu konnten aufgeklärt werden.Die untersuchten Systeme zeigen übersichtliche Verhältnisse; die Tendenz zur Verbindungsbildung steigt vom Kupfer zum Gold und vom Caesium zum Lithium. Breitere Homogenitätsgebiete treten nur bei den Li-haltigen Systemen auf.Die Raumchemie der Legierungen wird besprochen. Bei allen festen Lösungen und Legierungen sind die Alkalimetalle stark kontrahiert; bei nicht zu kleinem Gehalt an Edelmetall finden sich für die Alkalimetalle die „Volumeninkremente in intermetallischen Verbindungen“ nach W. Biltz.
    Additional Material: 20 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 65
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 12-25 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The neutralization-like reactions occuring in the ionizing solvent benzoyl fluoride between acid- and base-like compounds have been investigated by conductometric, potentiometric, and preparative methods. Similarly, replacement reactions between salt-like and strongly basic compounds were studied.From the potentiometric measurements, the maximum value of the ionic product of benzoyl fluoride at 20°C is supposed to be [C6H5CO+][F-] 〈 10-19.
    Notes: Die in dem ionisierenden Solvens Benzoylfluorid aufgefundenen Säuren- und Basenanalogen wurden in neutralisationsanalogen Umsetzungen zu den entsprechenden salzanalogen Verbindungen unter gleichzeitiger Bildung von Solvensmolekülen umgesetzt. Weiterhin wurden zwischen salzanalogen Verbindungen, die sich von einem schwachen Basenanalogen ableiten, und starken Basenanalogen Verdrängungstitrationen durchgeführt. Die Reaktionen wurden konduktometrisch und potentiometrisch verfolgt, teilweise wurden die gebildeten Salzanalogen präparativ dargestellt. Aus dem Verlauf der potentiometrischen Titrationen wurde die obere Grenze des Ionenproduktes des Benzoylfluorides bei 20° zu [C6H5CO+][F-] 〈 10-19 abgeschätzt.
    Additional Material: 18 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 66
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 26-31 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Solutions of GeCl4 in strong HCl (〉6 n) exhibit strong absorption in the UV-region at 2100-2150 Å, proportional to both HCl- and GeCl4-concentration and - at constant acid concentration - according to the Lambert-Beer law.The [GeCl6]2--ion is supposed to be the absorbing species. The molar extinction coefficient and the equilibrium constant of the reaction 2Cl- + GeCl4 ⇄ [GeCl6]2- have been estimated.Alkali chlorides enlarge the absorption efficieny of these solutions. The effect decreases from LiCl to CsCl.
    Notes: Salzsaure Lösungen von Germanium(IV)-chlorid zeigen oberhalb einer Salzsäurekonzentration von 6 n im UV-Gebiet von 2100-2150 Å eine starke Absorption, die sowohl der Salzsäure- als auch Germaniumkonzentration proportional ist. Im untersuchten Germaniumkonzentrationsbereich gilt bei konstanter Säurekonzentration das Lambert-Beersche Gesetz. Da weder eine wäßrige Lösung von GeO2 noch GeCl4 in Methanol unter vergleichbaren Konzentrationsbedingungen eine nennenswerte Absorption aufweisen, wird als absorbierender Körper in salzsaurer Lösung das GeCl62--Ion angenommen. Aus den Meßergebnissen konnte die Gleichgewichtskonstante der Reaktion 2 Cl- + GeCl4 ⇌ GeCl62- sowie der molare Extinktionskoeffizient berechnet werden. Alkalichloride erhöhen das Absorptionsvermögen salzsaurer Lösungen von GeCl4. Der Effekt nimmt innerhalb der Gruppe vom LiCl zum CsCl hin ab.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 67
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 121-122 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 68
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 123-142 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By reaction of (N2H5)2SO4 with NaBH4, hydrazine borine (m. p. 61°C) is obtained in good yields. Solubilities, dipole moment, crystal structure and IR-absorption were studied. In the pyrolysis of this compound, one mole of hydrogen and a part of the hydrazine are released. Under controlled conditions, H2B—NHNH—BH2 can be isolated from the products of pyrolysis in good yields as a crystalline polymeric compound, stable in water and acids. Powder diagrams and IR-spectra were taken. Further pyrolysis leads to instable or even explosive compounds with compositions near (HBN)n which contain still N—N-bonds.
    Notes: Durch Umsetzung von Hydrazinsulfat mit Natriumboranat wird das Monoborinhydrazin in guten Ausbeuten erhalten, Fp. 61°. Löslichkeiten, Dipolmoment, Kristallstruktur und IR-Spektren wurden untersucht. Bei der Pyrolyse wird rasch ein Mol Wasserstoff und ein Teil des Hydrazins abgeben. Aus den Reaktionsprodukten läßt sich unter bestimmten Versuchsbedingungen mit guten Ausbeuten H2B—NH—NH—BH2 isolieren, das als Polymeres vorliegt und gegenüber Wasser und auch Säuren unempfindlich ist. Auch diese Verbindung ist kristallin und wurde durch ihr Debyeogramm und ihr IR-Spektrum charakterisiert. Die weitere Pyrolyse führt zu wenig beständigen, teilweise explosiven Verbindungen der ungefähren Zusammensetzung (HBN)n, in der auch noch die N—N-Bindung des Hydrazins zum größten Teil erhalten ist.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 69
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 1-11 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The physical and solvent properties of benzoyl fluoride, acting as an ionizing solvent for many inorganic and organic compounds, have been investigated. Numerous compounds increase the poor specific self-conductivity of the pure solvent (χ20° = 1 · 10-8 mho cm-1). From the assumed small self-dissoziation of pure benzoyl fluoride according to C6H5COF ⇌ C6H5CO+ + F-, a classification of the soluble compounds is given on the basis of their acid-base-reactions.
    Notes: Im Rahmen von Untersuchungen an ionisierenden Lösungsmitteln wird Benzoylfluorid unter diesem Gesichtspunkt als Lösungsmittel untersucht. Die physikalischen Daten des Benzoylfluorides werden soweit bekannt zusammengestellt und teilweise erstmalig bzw. erneut bestimmt. Es wird ein Überblick über das Lösevermögen des Benzoylfluorides für anorganische und organische Stoffe gegeben. Zahlreiche Substanzen erhöhen beim Lösen in Benzoylfluorid die sehr geringe spezifische Eigenleitfähigkeit des reinen Lösungsmittels von χ20° = 1 · 10-8 ω-1 cm-1 bedeutend. Die spezifischen und molaren Leitfähigkeiten einiger dieser Verbindungen werden bestimmt. Als Ursache der geringen Eigenleitfähigkeit des reinen Benzoylfluorides muß eine sehr geringe Eigendissoziation des Benzoylfluorides nach C6H5COF ⇌ C6H5CO+ + F- angenommen werden. Entsprechend diesem Dissoziationsschema werden die in Benzoylfluorid löslichen Verbindungen in säuren-, basen- und salzanaloge Stoffe sowie in Substanzen, die in das Solvosystem des Benzoylfluorides nicht eingreifen, eingeteilt.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 70
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 32-42 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Symmetric bis-(silyl) hydrazines and monisilyl hydrazines with blocked functions at the neighbouring N-atom react with chlorosilanes only after metallation of a NH-group by LiC6H5, yielding tris- and asymm. bis-(trialkylsilyl) hydrazines, respectively (equations in „Inhaltsübersicht“).
    Notes: Symmetrisch zweifach silylsubstituierte Hydrazine reagieren nicht direkt mit Chlorsilanen, sondern erst nach vorangehender Metallierung einer NH-Gruppe durch Lithium-phenyl: R3SiNHNHSiR3 + LiC6H5 + R′3SiCl → ( R′3Si)(R3Si)NNHSiR3 + LiCl + C6H6.Das gleiche gilt für Monosilylhydrazine mit blockierten Funktionen am benachbarten N-Atom: R′R″NNHSiR3+ LiC6H5 + R3SiCl → R′R″NN(SiR3)2 + LiCl + C6H6.Es konnten so dreifach und asymmetrisch zweifach trialkylsilylsubstituierte Hydrazine bequem dargestellt werden.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 71
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 50-52 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Trimethyl chlorosilane reacts with sodium forming hexamethyl disilane the preparation of which is successful with aluminium chloride as a catalyst and special apparative methods. While t-butyl chloride forms under analogous conditions small amounts of hexamethyl ethane resp., together with trimethylchlorosilane, t-butyltrimethylsilane, experiments for the preparation of octamethyl trisilane have failed.
    Notes: Trimethylchlorsilan reagiert mit Natrium zum Hexamethyldisilan. Die präparative Darstellung gelingt mit Aluminiumchlorid als Katalysator und speziellen apparativen Maßnahmen. Während sich unter gleichen Bedingungen aus t-Butylchlorid geringste Mengen Hexamethyläthan bzw. mit Trimethylchlorsilan t-Butyltrimethylsilan bilden, schlagen Versuche zur Darstellung vom Octamethyltrisilan fehl.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 72
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 43-49 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Complex compounds of the general composition [{(C6H5)2P—P(C6H5)2}2MeX2] the nonelectrolytic character of which has been proved by measuring the conductivities are formed from (C6H5)2P—P(C6H5)2 and anhydrous salts MeX2—NiBr2, PdCl2, CoBr2, CoJ2 — in benzene resp. alcohol. The structural configuration of these complexes is discussed on the basis of molecular weight determinations, magnetic measurements and such of the dipole moments, respectively. CuCl reacts with (C6H5)2P—P(C6H5)2 in the molecular ration 1:1.
    Notes: Tetraphenyldiphosphin reagiert als einzähliger Komplexligand mit wasserfreiem NiBr2, PdCl2, CoBr2, CoJ2 in Toluol, Benzol bzw. Alkohol unter Bildung von Komplexen der allgemeinen Zusammensetzung [{(C6H5)2P—P (C6H5)2}2MeX2]. An Hand magnetischer Untersuchungen, Dipolmoment- und Leitfähigkeitsmessungen ist für [{(C6H5)2P—P (C6H5)2}2NiBr2], [{(C6H5)2P—P (C6H5)2}2PdCl2] u. [{(C6H5)2P—P (C6H5)2}2CoBr2] ein planquadratischer Bau anzunehmen. Das [{(C6H5)2P—P (C6H5)2}2CoJ2] ist auf Grund des magnetischen Verhaltens tetraedrisch konfiguriert. Kupfer(I)-salze setzen sich mit (C6H5)2P—P(C6H5)2 im Mol.-Verh. von 1:1 um. Das (C6H5)2P—P(C6H5)2 · CuCl gleicht hinsichtlich des strukturellen Aufbaues den analogen Kupfer(I)-Komplexen prim., sek. und tert. Phosphine.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 73
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 69-77 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The exchange reactions occurring rapidly and completely between Si—Cl- and Si—N-bonds in dilute benzene solutions have been investigated by dielectric measurements. The direction of exchange depends on the nature of other Si-ligands.
    Notes: Mit Hilfe einer dielektrischen Meßmethode wird gezeigt, daß in verdünnten benzolischen Lösungen bei Zimmertemperatur Austauschreaktionen zwischen SiCl- und SiN-Verbindungen vonstatten gehen, die rasch und völlig nach einer Seite verlaufen. Diese Reaktionen gestatten Aussagen über die nicht unmittelbar am Austausch beteiligten Gruppen.
    Additional Material: 10 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 74
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 53-68 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Several alkali-alkaline-earth-phosphates, -arsenates and -vanadates of the general formula MeIMeIIXVO4 have been prepared by sintering or fusing the respective components. Using the isotypism of these compounds with K2SO4, the lattice constants of the low-temperature (NT-) and high-temperature (HT-) modifications have been determined. The space groups are D2h16 for the NT-forms and D3d3 for the HT-forms.The HT-forms of NaBaPO4, NaSrPO4, NaBaAsO4, and of the vanadates of Sr and Ba are unstable, yielding the tertiary salts Me3IXO4 and Me3II(XO4)2 at higher temperatures.Investigating the behaviour of KSrPO4 and KSrVO4, it has been shown that this type of compounds is hydrolyzed to hydroxyapatites.
    Notes: Durch Sintern oder Schmelzen entsprechender Mischungen der Komponenten werden folgende Alkali-Erdalkaliphosphate, -arsenate und -vanadate hergestellt: Na(K)Ca(Sr, Ba) P(As, V)O4. Ausgehend von der Isotypie des Kaliumsulfates mit derartigen A2XO4-Verbindungen werden deren Gitterkonstanten für die rhombischen Niedertemperatur(NT)-bzw. für die hexagonalen Hochtemperatur(HT)-Formen berechnet. Alle Verbindungen kristallisieren in den Raumgruppen D2h16 bzw. D3d3. Die HT-Formen von NaBaPO4, NaSrAsO4, NaBaAsO4 und der Vanadate des Sr und Ba sind unbeständig. In diesen Fällen tritt beim Erhitzen Zersetzung zu tertiären Salzen Me3IXO4 und Me3II(XO4)2 ein. Der Grund für die Zersetzung kann aus der Feldstärkentheorie von Dietzel hergeleitet werden. - An den Beispielen des KSrPO4 und des KSrVO4 wird gezeigt, daß die Verbindungen durch Wasser zu den entsprechenden Hydroxylapatiten hydrolysiert werden.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 75
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 86-89 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: It is shown that the reaction between molybdenum pentachloride and methanol proceeds in two ways. The resulting compounds are described.
    Notes: Es wird gezeigt, daß die Reaktion zwischen Molybdänpentachlorid und Methylalkohol in zwei Richtungen verlaufen kann. Die Reaktionsprodukte werden beschrieben.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 76
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 78-85 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The dipole moments of some dimethyl aminosilanes are reported. There are considerable deviations from the additivity of constant bond moments, indicating a partial double bond character of the Si—N-bond.
    Notes: Die Dipolmomente einiger Dimethylaminosilanderivate wurden bestimmt. Der Vergleich der Dimethylaminochlorsilane mit den entsprechenden Methylchlorsilanen und Dimethylaminomethylsilanen zeigt bedeutende Abweichungen von der Additivität konstanter Bindungsmomente. Diese Abweichungen werden unter dem Gesichtspunkt der Herausbildung partieller Si—N-Doppelbindungen diskutiert.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 77
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 90-93 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The action of ammonia or amines on disulfuryl fluoride in a molar ratio of 2:1 does not lead to a substitution of fluorine at lower temperatures. The primary step in the reaction is the aminolytic fission of the (S—O—S)-bond. The reaction is suitable for the preparation of the amidosulphuric acid fluoride and its N-alkyl derivatives.
    Notes: Die Einwirkung von Ammoniak oder Aminen auf Disulfurylfluorid im Mol-Verhältnis 2:1 führt bei niederen Temperaturen nicht zu einer Fluor-Substitution. Der primäre Reaktionsschritt ist die ammonolytische Spaltung der S—O—S-Bindung. Die Umsetzung ist zur präparativen Gewinnung des Amidoschwefelsäurefluorids und seiner N-Alkylderivate geeignet.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 78
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 94-99 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The preparation of a number of esters of amidosulphonic acid from amidosulphonic acid chloride and alcoholates is described. The properties and reactions of the esters are communicated.
    Notes: Es wird die Darstellung einiger Ester der Amidoschwefelsäure aus Amidoschwefel-säurechlorid und Alkoholaten beschrieben. Eigenschaften und Reaktionen der Ester werden mitgeteilt.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 79
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 113-113 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 80
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 100-109 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Synthesis and properties of the compounds X(CH3)2SiNHSi(CH3)2X (X = H, C6H5, Cl, and Br) are described. The products of hydrolysis and the relative rate of hydrolysis  -  including that of (CH3)3SiNHSi(CH3)3  -  are studied. The results are discussed regarding bond properties and steric effects.
    Notes: Darstellung und Eigenschaften der Tetramethyldisilazane X(CH3)2SiNHSi(CH3)2X mit X = H, C6H5, Cl und Br werden beschrieben. Insbesondere wurden die Hydrolyseprodukte dieser Stoffe und die relative Hydrolysegeschwindigkeit einschließlich der des (CH3)3SiNHSi(CH3)3 näher studiert. Die Ergebnisse werden in bindungstheoretischer Hinsicht diskutiert.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 81
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 110-113 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The infrared spectra of NaHC2 and Na2C2, prepared by known procedures, were obtained. All the three expected frequencies for NaHC2 could be observed. The force constants were calculated. They show the expected decrease with the increase of lone electron pairs. For Na2C2 no C—C stretching frequency was observed. The compound is easily oxidized to carbonate.
    Notes: Nach bekannten Verfahren wurde Mono- und Di-Natriumacetylid dargestellt und deren Infrarot-Spektren aufgenommen. Bei der Monoverbindung wurden die drei zu erwartenden Frequenzen erhalten und die Kraftkonstanten berechnet. Auch bei diesem Ion bringt die Zunahme freier Elektronenpaare eine Verminderung der Kraftkonstante. In der Dinatriumverbindung konnte die C≡C-Valenzschwingung nicht ermittelt werden. Dagegen wurde leichte Oxydierbarkeit zu Carbonat festgestellt.
    Additional Material: 2 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 82
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 114-120 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Paper chromatography of PO(NH2)3 in liquid NH3 is described, and the RAMAN spectrum of the solid as well as the infrared spectrum of the aquous solution is given together with corrections of former assignments. By comparison of force constants and frequencies it is shown, that phosphorus in PO(NH2)3 and PS(NH2)3 as in a less electro-negative environment uses d-electrons for bonding only to a small degree.
    Notes: Die Papierchromatographie von PO(NH2)3 in flüssigen NH3 wird beschrieben und das RAMAN-Spektrum der festen Substanz sowie das Infrarotspektrum der wäßrigen Lösung mitgeteilt, zusammen mit Berichtigungen einer früheren Zuordnung. Durch Vergleiche von Kraftkonstanten und Frequenzen wird gezeigt, daß d-Elektronen des Phosphors in PO(NH2)3 und in PS(NH2)3 als in einer wenig elektronegativen Umgebung nur in einem geringen Maße an den Bindungen beteiligt sind.
    Additional Material: 2 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 83
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 84
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 185-194 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: From solutions of SrCl2 containing KH2PO4 in excess, well crystallized SrHPO4 is precipitated by KOH at pH = 6-8. At higher pH-values, strontium hydroxy-apatite is obtained. If SrCl2 is in excess, at all pH-values hydroxy-apatite is formed. Alkali chlorides favourise the formation of apatite; in the presence of them, apatite is formed at all pH-values if their concentration is at least 1,5 n.Barium ions form at pH = 6-8 the secondary phosphate, too. At higher pH-values, however, tertiary phosphate is obtained instead of apatite. In the presence of alkali chlorides, barium hydroxy-apatite is precipitated from aqueous solutions only at pH = 10.
    Notes: Aus Strontiumchloridlösungen, die überschüssiges KH2PO4 enthalten, fällt mit KOH be pH 6-8 gut kristallisiertes sekundäres Strontiumphosphat, bei höheren pH-Werten dagegen Strontiumhydroxylapatit. Liegt überschüssiges SrCl2 vor, so entsteht bei allen pH-Werten nur Hydroxylapatit. Alkalichloride begünstigen die Apatitbildung; in ihrer Gegenwart fällt, sofern ihre Konzentration mindestens 1,5 n beträgt, ebenfalls bei allen pH-Werten Apatit aus. - Bariumionen liefern bei pH 6-8 ebenfalls das sekundäre Phosphat, bei höheren pH-Werten jedoch nicht Apatit, sondern das tertiäre Phosphat. Barium-hydroxylapatit wird aus wäßrigen Lösung in Gegenwart von Alkalichloriden erst bei pH 10 ausgefällt.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 85
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 195-203 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Paper chromatography and paper electrophoresis have shown that fluorozirconium and hydroxofluoro zirconium komplexes are easily altered.The easily hydrolyzable pentafluorozirconates have been identified by means of a weakly acid chromatography solvent. Because of the complete dissoziation \documentclass{article}\pagestyle{empty}\begin{document}$$ \left[{{\rm ZrF}_{\rm 7} } \right]^{3 - } \mathbin{\lower.3ex\hbox{$\buildrel\textstyle\rightarrow\over{\smash{\leftarrow}\vphantom{_{\vbox to.5ex{\vss}}}}$}} \left[{{\rm ZrF}_{\rm 6} } \right]^{2 - } + {\rm F}^{\rm - } $$\end{document} occuring during the chromatographic ion separation experiment, only [ZrF6]2-ions are detectable on the chromatogram. Kationic zirconium complexes are formed in strongly acid chromatography solvents.
    Notes: Mit Hilfe von papierchromatographischen und -elektrophoretischen Untersuchungen wird gezeigt, daß Fluorozirkon- und Hydroxofluorozirkon-Komplexe je nach den angewandten Bedingungen sehr leicht Veränderungen unterliegen können. Der Nachweis der leicht hydrolysierenden Pentafluorozirkonate gelingt mit einem schwach sauren Laufmittel. Heptafluorozirkonate dissoziieren wegen der Ionentrennung vollständig nach \documentclass{article}\pagestyle{empty}\begin{document}$$ \left[{{\rm ZrF}_{\rm 7} } \right]^{3 - } \mathbin{\lower.3ex\hbox{$\buildrel\textstyle\rightarrow\over{\smash{\leftarrow}\vphantom{_{\vbox to.5ex{\vss}}}}$}} \left[{{\rm ZrF}_{\rm 6} } \right]^{2 - } + {\rm F}^{\rm - } $$\end{document} so daß nur [ZrF6]2--Ionen auf dem Chromatogramm sichtbar gemacht werden können. Bei Verwendung stark saurer Laufmittel bilden sich kationische Zirkon-Komplexe.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 86
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 204-216 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Acid hydrolysis of K- and [NH4][ZrF5(H2O)] yields K1.5H0.5Zr2F8O and [NH4]1.3H0.7Zr2F8O, respectively. By alkaline hydrolysis of K- and NH4-fluorozirconates, the compounds K- and [NH4][ZrF3(OH)2(H2O)] are formed. These are easily dehydrated to K- and [NH4]ZrF3(OH)2, respectively. It is assumed that in the two latter compounds as well as in KZrF5 and [NH4]ZrF5 zirconium has a higher co-ordination number than 5, resulting from fluorine bridging.The thermal decomposition reactions \documentclass{article}\pagestyle{empty}\begin{document}$ \left[{{\rm NH}_{\rm 4} } \right]{\rm ZrF}_{\rm 3} \left({{\rm OH}} \right)_2 \buildrel \Delta \over \longrightarrow \left[{{\rm NH}_{\rm 4} } \right]_2 {\rm Zr}_{\rm 4} {\rm F}_{{\rm 12}} {\rm O}_{\rm 3} \buildrel { 〉 240^ \circ } \over \longrightarrow {\rm Zr}_{\rm 4} {\rm F}_{{\rm 10}} {\rm O}_{\rm 3} $\end{document} and \documentclass{article}\pagestyle{empty}\begin{document}$$ {\rm KZrF}_{\rm 3} \left({{\rm OH}} \right)_2 \buildrel \Delta \over \longrightarrow {\rm KZrF}_{\rm 3} {\rm O} $$\end{document} yielding still higher molecular compounds are discussed.
    Notes: Durch saure Hydrolyse von Kalium- und Ammoniumpentafluorozirkonatmonohydrat, die mit [ZrF5(H2O)]--Ionen zur formulieren sind, entstehen die Verbindungen K1,5H0,5Zr2F8O bzw. [NH4]1,3H0,7Zr2F8O. Die alkalische Hydrolyse von Kalium- und Ammoniumfluorozirkonaten führt zu den Verbindungen K[ZrF3(OH)2(H2O)] und [NH4][ZrF3(OH)2(H2O)], die sich leicht zu KZrF3(OH)2 bzw. [NH4]ZrF3(OH)2 entwässern lassen. Es ist anzunehmen, daß in den wasserfreien Verbindungen sowie in KZrF5 bzw. [NH4]ZrF5 nicht die Koordinationszahl 5 am Zirkon vorliegt, sondern durch Fluorbrücken eine höhere Koordination erreicht wird. Die thermische Zersetzung von [NH4]ZrF3(OH)2 führt zur [NH4]2 Zr4F12O3, das oberhalb 240° unter [NH4]F-Abspaltung in das definierte Oxyfluorid Zr4F10O3 übergeht. KZrF3(OH)2 liefert bei der thermischen Zersetzung die außerordentlich schwer lösliche Verbindung KZrF3O. Alle nicht in Komplexklammern eingefaßten Anionen-Gruppierungen sind nur als Baueinheiten zu verstehen, die über Fluorbrücken zu höher molekularen Gebilden zusammengefaßt sind.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 87
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 169-179 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Ditertiary phosphines of the type (C6H11)2P—(CH2)n—P(C6H11)2 - with n = 3; 4; 5 - react with anhydrous nickel, cobalt and iron salts forming chelate complexes of the general composition [(C6H11)2P—(CH2)n—P(C6H11)2MeX2] - (Me = Ni, Co, Fe; X = Cl, Br, J, NO3). Whereas the cobalt complexes have a tetrahedral configuration, those of nickel are diamagnetic and have a planar arrangement of ligands. The preparations of [(C6H11)2P—;(CH2)3—P(C6H11)2CuBr] (coordination number of copper = 3) and [(C6H11)2P—(CH2)5—P(C6H11)2Cu2Br2] are described.
    Notes: Die ditertiären Phosphine vom Typ des Trimethylen-1,3-, des Tetramethylen-1,4- und des Pentamethylen-1,5-dicyclohexylphosphins bilden mit wasserfreien Nickel-, Kobalt- und Eisen(II)-Salzen Komplexe der allgemeinen Formel [(C6H11)2P—(CH2)n—P(C6H11)2MeX2], wobei die Liganden mit dem Zentralatom komplexcyclische 6-, 7- und 8-Ringe bilden. Während die Chelatkomplexe des Nickels allgemein planquadratisch konfiguriert sind, weisen diejenigen des Kobalts einen Tetraederbau auf. Die Eisen(II)-Komplexe sind relativ instabil, was eine lockere Koordination der ditertiären Phosphine andeutet, so daß Strukturaussagen auf Grund von Dipolmoment- sowie magnetischen Messungen und Molekulargewichtsbestimmungen nicht möglich sind. Die Kettenlänge zwischen den beiden Phosphoratomen ist nur bei der Bildung der Nickel- und der Kupfer(I)-Komplexe von Einfluß. So vermag (C6H11)2P—(CH2)5—P(C6H11)2 mit NiCl2 das vermutlich trans-konfigurierte [(C6H11)2P—(CH2)5—P(C6H11)2NiCl2] zu bilden. In den analogen Verbindungen des (C6H11)2P—(CH2)3—P(C6H11)2 und des (C6H11)2P—(CH2)4—P(C6H11)2 erfolgt die Fixierung der Liganden in cis-Stellung. Gegenüber Kupfer(I)-bromid verhält sich (C6H11)2P—(CH2)3—P(C6H11)2 als zweizähliger Ligand, wobei eine Substanz der Formel [(C6H11)2P—(CH2)3—P(C6H11)2CuBr] mit koordinativ dreizähligem Kupfer resultiert. Bei entsprechender Reaktion des (C6H11)2P—(CH2)5—P(C6H11)2 entsteht hingegen das [(C6H11)2P—(CH2)5—P(C6H11)2Cu2Br2], und bei Verwendung des (C6H11)2P—(CH2)4—P(C6H11)2 können beide Komplextypen auftreten.
    Additional Material: 2 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 88
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 195-200 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The interaction between S4N4 and diphenyl diazomethane or fluorenyl diazomethane yields bis-diphenyl-methylene trisulfur tetranitride, [(C6H5)2C]2S3N4, and difluorenyliden trisulfur tetranitride, (C13N8)2S3N4, respectively. The preparation methods and the properties of these compounds are described. A reaction mechanism is proposed.
    Notes: Es wurde die Reaktion von S4N4 mit Diazomethanverbindungen untersucht. Die Umsetzung von S4N4 mit Diphenyldiazomethan und Fluorenyldiazomethan führt zu Bisdiphenylmethylen-trischwefel-tetranitrid, [(C6H5)2C]2S3N4, und Difluorenyliden-trischwefeltetranitrid, (C13H8)2S3N4. Herstellung und Eigenschaften dieser Verbindungen sind beschrieben. Für ihre Bildung wird ein Reaktionsmechanismus vorgeschlagen.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 89
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 221-224 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: VICKERY asserts scandium hydroxide to be precipitated very incompletely by an aqueous solution of ammonia. This statement is criticized and in contrast it is shown that using the normal conditions of analytical chemistry the precipitation is quantitative. It has to be supposed that the differing observations of VICKERY are caused by methodic errors which probably explain further improbable results published by the author.
    Notes: Die Behauptung VICKERYS, daß Scandiumhydroxid durch Ammoniaklösung nur sehr unvollständig ausgefällt werde, wird kritisiert. Es wird gezeigt, daß die Fällung bei den üblichen analytisch-chemischen Bedingungen quantitativ erfolgt. Die abweichenden Befunde VICKERYS lassen einen methodischen Fehler vermuten, der wahrscheinlich auch weitere Ergebnisse seiner Arbeit entstellt hat.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 90
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 230-232 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: In den Systemen Hg(CNS)2—KCN—H2O und Hg(CN)2—KCNS—H2O wurden die Verbindungen KHg(CNS)2CN(I), KHg(CN)2CNS(II) und K2Hg(CN)4(III) erhalten. Während I und III nur aus Lösungen bestimmter Zusammensetzung (KCN · Hg(CNS)2) bzw. 4KCN · 4 Hg (CNS)2 erhalten wurden, kristallisiert II aus Reaktionsmischungen mit starker Variation der Komponenten.
    Notes: The compounds KHg(CNS)2CN(I), KHg(CN)2CNS(II) and K2Hg(CN)4(III) have been isolated from the systems: Hg(CNS)2-KCN—H2O and Hg(CN)2—KCNS—H2O. Whereas I and III are obtained from reaction mixtures of the compositions KCN · Hg(CNS)2 and 4 KCN · Hg(CNS)2, II crystallises out from reaction mixtures constituted with large variations of the components.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 91
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The preparation of bis-benzene-chromium(0) in almost theoretical yield is described (one easy catalytic normal-pressure and two room-temperature procedures).The rôle of the aluminium halogenide catalyst forming an intermediate compound of the composition „3[Cr(C6H6)2]AlHal4 · 4 AlHal3“ (with Hal = Cl, Br) has been elucidated.The isolation of this primary complex, its behaviour against ligand exchange, as well as the stability of bis-benzene-chromium(0) and the disproportionation of the [Cr(C6H6)2]+-cation in alkaline solution are communicated.
    Notes: Es werden optimale Bedingungen für die Di-benzol-chrom-Synthese mit fast quantitativer Ausbeute ermittelt, ein bequemes, katalytisches Normaldruckverfahren wird beschrieben und zwei Raumtemperaturverfahren werden angegeben. Es gelingt, die Reaktion in Teilschritte aufzulösen und die Wirkungsweise des Aluminiumhalogenids zu klären. Das Primärprodukt ist „3 [Cr(C6H6)2]AlHal4 · 4 AlHal3“. Es entsteht auch aus Di-benzol-chrom(0) und AlHal3(Hal = Cl, Br) unter Abscheidung von pyrophorem Aluminium.Am Primärkomplex wird ein rascher Ligandenaustausch festgestellt, während Dibenzol-chrom(0) kinetisch bis zu seiner Zersetzungstemperatur völlig stabil ist.Die partielle alkalische Disproportionierung des [Cr(C6H6)2]+-Kations wird beschrieben.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 92
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 277-281 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Cs3TbF7, the first fluoro complex of TbIV, has been prepared. The compound is colourless, relatively stable on exposure to air, and paramagnetic (μ = 7.4 μB). According to the powder diagram, Cs3TbF7 is cubic (a = 9,80 Å; Z = 4 formula units per unit cell; dX-ray = 4.88, dpyk = 4.63 g · cm-3) and probably isotype with (NH4)3ZrF7.
    Notes: Als erster Fluorokomplex des vierwertigen Terbiums wurde Cs3TbF7 erhalten, eine farblose, auch an feuchter Luft recht beständige, paramagnetische (μ = 7,4 μB) Verbindung. Nach Pulveraufnahmen kristallisiert sie kubisch (Z = 4, a = 9,80 Å; drö = 4,88, dpyk = 4,63 g · cm-3), vermutlich im (NH4)3ZrF7-Typ.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 93
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The mixed-crystal systems SnTe—GeTe, SnTe—SnSe, PbSe—SnSe, and GeTe—SnSe are described. Only in the system SnTe—GeTe, complete miscibility occurs; the other systems exhibit miscibility gaps extending to about 40 mole-%. Vegards law is more or less valid.
    Notes: Es werden die Mischkristallsysteme beschrieben: SnTe—GeTe, SnTe—SnSe, PbSe—SnSe, GeTe—SnSe. Im allgemeinen treten Mischungslücken auf über einen Bereich von etwa 40 Mol-%. Nur das heterotype Mischkristallsystem SnTe—GeTe ist lückenlos. Die VEGARDsche Regel ist mehr oder weniger gut erfüllt.
    Additional Material: 8 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 94
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 313 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 95
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 313 (1961), S. 37-47 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: According to the method of Rice, Freamo, and Grelecki solid chloroamine has been decomposed at -190 °C by ultraviolet irradiation. The blue product formed is stable below -150 °C; it is already known from the analogous decomposition of hydrogen azide, and its formation can be understood only by the primary formation of nitrogen monohydride.  -  This result is supported by the identification of hydrogen cyanate during the thermal decomposition of gaseous chloroamine in the presence of carbon mon oxide (5 to 10 Torr, 500 °C). Under the same conditions, hydrazine too produces hydrogen cyanate.  -  Considering the result of Wannagat and Kohnen, who showed nitrogen monohydride and ammonia to form hydrazine, it follows that it is possible to synthesize hydrazine from chloroamine and ammonia via nitrogen monohydride as an intermediate.
    Notes: In Anlehnung an die Methodik von Rice, Freamo und Grelecki wurde festes Chloramin bei -190 °C durch ultraviolette Strahlung zersetzt. Das entstehende blaue Produkt, beständig unterhalb -150 °C, ist bereits durch die entsprechende Zersetzung des Hydrogenazids bekannt; seine Bildung ist nur durch primäres Auftreten von Stickstoffmonohydrid zu erklären.  -  Dieses Ergebnis wird durch den Nachweis von Hydrogencyanat im Anschluß an die thermische Zersetzung gasförmigen Chloramins in Gegenwart von Kohlenmonoxid (5 bis 10 Torr, 500 °C) bekräftigt. Auch Hydrazin liefert unter diesen Bedingungen Hydrogencyanat.  -  Unter Berücksichtigung des Befundes von Wannagat und Kohnen, daß Stickstoffmonohydrid mit Ammoniak zu Hydrazin reagieren kann, folgt, daß es ein experimentell gangbarer Weg ist, Hydrazin aus Chloramin und Ammoniak über Stickstoffmonohydrid als Zwischenprodukt zu synthetisieren.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 96
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 236-241 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The compound [SbCl4][SbF6], being the isomeric ionic form of the fluorination-catalyst SbCl2F3, has been prepared from SbF3 and Cl2.
    Notes: Es wird die aus SbF3 und Cl2 zu gewinnende Verbindung [SbCl4][SbF6] beschrieben, eine heteropolare isomere Form zu der als Fluorierungskatalysator patentierten Substanz SbCl2F3.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 97
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 242-247 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Antimony(V) chloride dissolves in acetonitrile forming the ions [SbCl4]+ and [SbCl6]-. The solvate SbCl5 · CH3CN (mp.: 175°C) is supposed to be the heteropolar compound [SbCl4][SbCl6] · 2 CH3CN.
    Notes: Antimon(V)-chlorid löst sich in Acetonitril unter Ausbildung der komplexen Ionen [SbCl4]+ und [SbCl6]-. Die aus der Lösung abzuscheidende Verbindung SbCl5 · CH3CN sollte, nach dem relativ hohen Schmelzpunkt von 175°C beurteilt, ebenfalls heteropolar gebaut sein und wird als [SbCl4][SbCl6] · 2 CH3CN formuliert.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 98
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 313 (1961), S. 117-120 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By tempering an equimolar mixture of Li2CO3 and α-Al2O3 at 600 °C, a low-temperature form of LiAlO2 is formed (α = 3.38 g · cm-3). Above 600 °C, it is slowly and apparently irreversibly converted to the well-known high-temperature form. The structural relation between high- and low-LiAlO2 is probably similar to that between α- and β-NaFeO2.
    Notes: Beim Tempern eines äquimolaren Gemisches von Li2CO3 und α-Al2O3 bei 600° entsteht eine Tieftemperaturform des LiAlO2 mit der Dichte 3,38 g · cm-3, die sich oberhalb 600°C langsam und anscheinend irreversibel in die bekannte Hochtemperaturform umlagert. T- und H-LiAlO2 stehen wahrscheinlich im gleichen Verhältnis zueinander wie α- und β-NaFeO2.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 99
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 313 (1961), S. 138-143 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Procedures are described for the easy preparation of POCl2Br, POClBr2, PSCl2Br, and PSClBr2 with good yields and high putiries. An improved method is given for PSBr3. The IR-spectra of these compounds were taken and discussed.
    Notes: Ein Verfahren zur bequemen Darstellung von POCl2Br, POClBr2, PSCl2Br und PSClBr2 in guter Ausbeute und Reinheit wird beschrieben und eine vereinfachte Darstellungsvorschrift für PSBr3 angegeben. Die IR-Spektren der genannten Verbindungen werden diskutiert.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 100
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 313 (1961), S. 154-160 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By fluorination of mixtures MICl/CeO2, the colourless, diamagnetic compounds M3CeF7 (M = Na, Rb, Cs) and M2CeF6 (M = Na, K, Rb, Cs) have been obtained. Na3CeF7 cristallizes tetragonal (a = 5.45 Å, c = 10.80 Å, Z = 2), being isotyp with Na3UF7; Cs3CeF7 and Rb3CeF7 are cubic (a = 9.93 resp. 9.52 Å, Z = 4).
    Notes: Durch Fluorierung geeigneter Mischungen MICl/CeO2 wurden die farblosen, diamagnetischen Verbindungen M3CeF7 (M = Na, Rb, Cs) und M2CeF6 (M = Na, K, Rb, Cs) erhalten. Na3CeF7 kristallisiert tetragonal (a = 5,45 Å, c = 10,80 Å, Z = 2) im Na3UF7-Typ, Cs3CeF7 und Rb3CeF7 kubisch (a = 9,93 bzw. 9,52 Å, Z = 4).
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...