Library

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • 2000-2004
  • 1960-1964  (739)
  • 1945-1949
  • 1961  (739)
  • Inorganic Chemistry  (739)
Material
Years
  • 2000-2004
  • 1960-1964  (739)
  • 1945-1949
Year
  • 1
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 233-233 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 2
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 1-2 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 3
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 13-22 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The conditions for preparing AlB2 from Al and B have been investigated. In all experiments at 800°C, a boron phase, containing small amounts of Al, was formed as a by-product of AlB2. The formation of AlB2 depends mainly from the degree of dispersion of the reaction components. Above 980°, AlB2 decomposes into Al and β-AlB2. The conditions for crystallising AlB2-sheets from molten Al, containing E, have been examined.
    Notes: Die Darstellungsbedingungen für AlB2 aus Al und B werden eingehend untersucht. Bei ∼800 °C bildet ein kleiner Teil des Bors stets eine aluminiumarme Phase, die neben dem AlB2 anfällt. Der Umsetzungsgrad zu AlB2 hängt vor allem von dem Verteilungsgrad der Reaktionskomponenten ab. Oberhalb 980° zerfällt AlB2 in Al und β-AlB12. Weiterhin wurden die Bedingungen für die Bildung blättchenförmiger AlB2-Kristalle aus borhaltigen Aluminiumschmelzen nachgeprüft.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 4
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 5
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 113-119 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Various mixtures of phosphorus trichloride and triethyl phosphite on one side and triphenyl phosphite and tris-diethylamino phosphine on the other side were prepared to study the equilibria resulting from reorganization in both systems. The equilibrium constants are compared with values calculated on the basis of completely random reorganization. It is shown that the mixed compounds of both systems are more stable than would be expected from statistical calculations.
    Notes: Es wurden Mischungen von Phosphortrichlorid und Triäthylphosphit einerseits und Triphenylphosphit und tris-Diäthylaminophosphin andererseits hergestellt und die sich in diesen beiden Systemen durch Ligandenaustausch einstellenden Gleichgewichte untersucht. Die Gleichgewichtskonstanten der Systeme werden mit denen verglichen, die sich bei rein statistisch-zufälliger Verteilung der Liganden ergeben würden. Es wurde gezeigt, daß die Verbindungen mit verschiedenen Liganden in beiden untersuchten Systemen eine größere Stabilität aufweisen, als man nach der Statistik erwarten würde.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 6
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 123-136 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By diffusion annealing of the solid metals Mg and Zr at 614°C and by interaction between liquid Mg and compact Zr, following phases have been obtained: α-mixed-crystal, intermetallic phase δ with a homogeneity range from about 60 to 70% Zr, and α-Zr-mixedcrystal (solid solution of Mg in α-Zr) with a content of Mg up to 15% Mg at 800°C.Several alloys with contents of Zr from about 54 to 85% have been prepared by powder metallurgy. There is a maximum of Brinell hardness at 50-70% Zr.Preliminary annealing experiments have been made in the system Mg—Zn—Zr.
    Notes: Bei Diffusionsglühungen der festen Metalle bei 614°C und von flüssigem Mg mit kompaktem Zr bei 800°C entstehen im Diffusionsgefüge folgende Phasen: α-Mischkristall, intermetallische Phase δ mit Homogenitätsbereich von zunächst ungefähr 60 bis 70% Zr und α-Zr-Mischkristall (feste Lösung von Mg in α-Zr) mit möglicherweise bis zu 15% Mg bei 800°C.Nach der pulvermetallurgischen Methode wurden eine Reihe von Legierungen mit 54-85% Zr hergestellt. Auf der Mg-Seite wurden diese durch Legierungen aus Mg-Schmelzen mit Zr-Zusatz ergänzt. Brinellhärtemessungen lieferten eine Härte-Konzentrationskurve, die zwischen ungefähr 50 und 70% ein ausgeprägtes Maximum aufwies. Dies sowie Debye-Scherrer-Aufnahmen und die mikroskopische Untersuchung der Legierungen bestätigten das Vorhandensein Zr-reicher Phasen zwischen ∽50 und 70% und etwa 85 bis 100% Zr.Im System Mg—Zn—Zr wurden orientierende Diffusionsglühungen angestellt.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 7
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 137-144 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: CsCl and CoCl2 form a fourfold eutectical system with the compounds Cs3CoCl5, Cs2CoCl4 and CsCoCl3. Two other compounds - Cs5Co2Cl9 and Cs3Co2Cl7 - decompose in the solid state.In the system RbCl/CoCl2 there are: Three eutectics, the compounds Rb2CoCl4 and RbCoCl3, further on the compound Rb3CoCl5, the melting point of which is also a peritectic. Rb2CoCl4 has a transition point.The system KCl/CoCl2 shows the congruently melting compound K2CoCl4, the incongruently melting KCoCl3 (with a transition point in the solid state), two eutectics and a peritectic.For NaCl and CoCl2 the same diagram was found as already described in literature.LiCl and CoCl2 form mixed crystals with a minimum on the LiCl-side; on the CoCl2-side there is an peritectical system. At lower temperature, a miscibility gap exists. In the space of this miscibility gap the compounds Li4CoCl6, Li2CoCl4 and LiCoCl3 are formed.The melting point of CoCl2 has been newly determined. The effects of moisture and some solvents on these compounds are described.References to the possible structures are given.
    Notes: CsCl und CoCl2 bilden ein vierfach eutektisches System mit den Verbindungen Cs3CoCl5, Cs2CoCl4 und CsCoCl3. Zwei weitere Verbindungen  -  Cs5Co2Cl9 und Cs3Co2Cl7  -  zersetzen sich im festen Zustand.Im System RbCl/CoCl2 liegen vor: Drei Eutektika, die Verbindungen Rb2CoCl4 und RbCoCl3, sowie die Verbindung Rb3CoCl5, mit deren Schmelzpunkt ein Peritektikum zusammenfällt. Rb2CoCl4 besitzt einen Umwandlungspunkt.Aus KCl und CoCl2 bilden sich das kongruent schmelzende K2CoCl4 und das inkongruent schmelzende KCoCl3, das noch einen Umwandlungspunkt besitzt. Dazu gehören zwei Eutektika und das Peritektikum.Das schon beschriebene Diagramm des Systems NaCl/CoCl2 konnte bestätigt werden.Zwischen LiCl und CoCl2 herrscht auf der LiCl-reichen Seite Mischkristallbildung mit Minimum, die dann auf der CoCl2-reichen Seite in ein Peritektikum übergeht. In der Mischungslücke bilden sich bei tieferen Temperaturen die Verbindungen Li4CoCl6, Li2CoCl4 und LiCoCl3.Der Schmelzpunkt des CoCl2 wurde neu bestimmt.Das Verhalten der Verbindungen gegen Feuchtigkeit und einige Lösungsmittel wird beschrieben. Hinweise über die möglichen Strukturen werden gegeben.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 8
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 163-173 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Nb3O7Cl is formed by thermal interaction (600°C) between Nb2O5 and NbOCl3 as colourless single crystals (in the presence of O2 or Cl2) or as blue crystals (in the absence of any oxidizing agents). It is thermally transportable according to the heterogeneous equilibrium \documentclass{article}\pagestyle{empty}\begin{document}$$ {\rm NbOCl}_{{\rm (s)}} + 4{\rm NbCl}_{{\rm 5(g)}} \mathbin{\lower.3ex\hbox{$\buildrel\textstyle\rightarrow\over{\smash{\leftarrow}\vphantom{_{\vbox to.5ex{\vss}}}}$}} 7{\rm NbCl}_{{\rm 3(g)}}. $$\end{document}NbOCl2 results from the reduction of NbOCl3 by H2 or from the interaction between Nb, NbCl5 and Nb2O5 in a sealed tube at 370/350°C; there is a transport reaction according to \documentclass{article}\pagestyle{empty}\begin{document}$$ {\rm NbOCl}_{{\rm 2(s)}} + {\rm NbCl}_{{\rm 5(g)}} \mathbin{\lower.3ex\hbox{$\buildrel\textstyle\rightarrow\over{\smash{\leftarrow}\vphantom{_{\vbox to.5ex{\vss}}}}$}} {\rm NbOCl}_{{\rm 3(g)}} + {\rm NbCl}_{{\rm 4(g)}}. $$\end{document}At analogous conditions, the diamagnetic compound TaOCl2 has been prepared by the transport reactions between SiO2, Ta and TaCl5 or Ta2O5, Ta and TaCl5.
    Notes: Nb3O7Cl wurde durch Erhitzen (600°C) von Nb2O5 mit einem NbOCl3-Überschuß hergestellt. In Gegenwart von O2 oder Cl2 erhält man farblose Einkristalle. Wird ohne Zugabe von Oxydationsmitteln gearbeitet, so entstehen blaue Kristalle der gleichen Verbindung. Sie besitzt somit ein Homogenitätsgebiet. Nb3O7Cl ist mit Hilfe des heterogenen Gleichgewichts Nb3O7Cl + 4 NbCl5g = 7 NbOCl3g im Temperaturgefälle transportierbar.NbOCl2 entsteht bei der Reduktion von NbOCl3 mit 2. Zu seiner Darstellung setzt man am besten Nb, NbCl5 und Nb2O5 und Nb2O5 bei 370/350°C im Einschlußrohr um. Man kann die Synthese mit dem Transport im Temperaturgefälle verbinden, der nach der Gleichung NbOCl2 + NbCl5g = NbOCl3g + NbCl4g vor sich geht.TaOCl2 konnte durch Umsetzung von SiO2, Ta und TaCl5 oder von Ta2O5, Ta und TaCl5 im Einschlußrohr gewonnen werden. Die Verbindung erwies sich als dem NbOCl2 in vieler Hinsicht ähnlich und konnte auch auf die analoge Weise im Temperaturgefälle transportiert werden. TaOCl2 ist diamagnetisch.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 9
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 202-204 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Beim Erhitzen von Zr und Te bzw. aus ZrO2 und Te entsteht unter Luftzutritt bei 750°C die Verbindung ZrO2 · 2 TeO, die röntgenographisch untersucht wurde.
    Notes: By heating Zr and Te or ZrO2 and Te in air at 750°C the compound ZrO2 · 2 TeO results. The crystal parameters have been determined.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 10
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 187-201 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The conversion of normal kaolinite into H-kaolinite by means of dilute acids, organic cation exchangers, and electrodialysis has been studied.By interaction between kaolinite and an acid exchange resin, a H-kaolinite has been prepared; 90% of its exchange sites were occupied by H- and Al-ions. The nature of the Al-exchange has been investigated.Similarly, the preparation of a H-montmorillonite and its inner-crystalline swelling were studied.
    Notes: Die verschiedenen Verfahren zur Belegung von Tonmineralen mit austauschfähigen Wasserstoffionen wurden miteinander verglichen. An den durch Behandeln eines Kaolinits mit sehr verdünnten Säuren. mit einem organischen Kationenaustauscher und durch Elektrodialyse hergestellten H-Kaoliniten wurde das Verhalten der neben den austauschfähigen H-Ionen stets vorhandenen austauschfähigen Al-Ionen studiert.Als wirksamstes und schonendstes Verfahren erwies sich die Behandlung mit einem stark sauren organischen Kationenaustauscher. Nach diesem Verfahren wurde eine größere Menge H-Kaolinit hergestellt, die bei nur unbedeutendem Angriff auf das Kaolinitgitter zu 90% (H + Al)-Ionen enthielt und sich für die Untersuchung der charakteristischen Eigenschaften des H-Kaolinits geeignet erwies.Es gelang, nach dem gleichen Verfahren einen Montmorillonit mit Wasserstoffionen zu belegen. Die innerkristalline Quellung dieses H-Montmorillonits wurde röntgenographisch untersucht.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 11
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 208-218 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Several alkali periodato- and tellurato-cuprates(III) have been prepared at definite values of pH. Their chemical and physicochemical properties (solubilities, thermal stabilities, magnetic behaviours) are communicated.
    Notes: Durch Regulation der Wasserstoffionenkonzentration ist es möglich, die bisher nicht dargestellten Komplexe des dreiwertigen Kupfers zu isolieren. Die isolierten kristallinischen Komplexe wurden durch chemische Analyse und Röntgen-Pulverdiagramme charakterisiert; außerdem wurde ihre Löslichkeit, thermische Stabilität und magnetische Suszeptibilität bestimmt.
    Additional Material: 8 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 12
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 226-228 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Mitteilung der Raumgruppe und Dimensionen der Elementarzelle von Mangan(II)-sulfat-monohydrat.
    Notes: Manganese(II) sulphate monohydrate is monoclinic prismatic with space group A 2/a—C2h6 and the cell-dimensions are a = 7.758 ± 0.008 Å, b = 7.612 ± 0.008 Å, c = 7.126 ± 0.008 Å, β = 115° 421/2′ ± 2′. The unit cell contains (MnSO4 · H2O)4 and the calculated density at 25°C is 2.960 g./cm3.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 13
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 14
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 234-234 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 15
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 265-275 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The dissociation properties of mono- and dicacodylatochromium(III) complexes in aqueous solutions have been investigated by physico-chemical methods.Coupled with an acid dissociation, there is a secondary complex dissociation yielding free cacodylic acid and basic chromium(III) complexes.
    Notes: Mit Hilfe physikalisch-chemischer Verfahren werden ein Mono- sowie ein Dikakodylatokomplex des dreiwertigen Chroms nachgewiesen und deren Verhalten in wäßriger Lösung untersucht. Hierbei wird vor allem eine mit einer Säuredissoziation gekoppelte sekundäre Komplexdissoziation festgestellt, die einerseits zur Abspaltung freier Kakodylsäure, andererseits zur Bildung basischer Chrom(III)-komplexe führt.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 16
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 290-303 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Arsenic acid esters react with HF or AsF3 forming esters of monomeric fluoroarsenic acids. These are only stable as addition compounds with one mole of alcohol, e. g. FAsOH-(OR)3, exhibiting the coordination number 5. In polar solvents, a rearrangement to heteropolar compounds with both the coördination numbers 4 and 6, e. g. [AsOH(OR)3]- [AsOH(OR)3F2]-, produced by transference of fluorine, occurs.
    Notes: Monomere Fluoroarsensäureester entstehen aus Arsensäureestern durch Reaktion mit HF oder mit AsF3. Sie sind nicht in der Form FAsO(OR)2 bzw. F2AsO(OR) mit Koordinationszahl 4 am Arsen beständig, sondern erst nach Anlagerung eines Mols Alkohol, wobei die Koordinationszahl 5 ausgebildet wird, z. B. FAsOH(OR)3. In dieser Form lösen sich die Ester in unpolaren Lösungsmitteln, wobei schon bei verhältnismäßig niedriger Konzentration eine Aggregation eintritt. In polaren Lösungsmitteln lösen sie sich als heteropolare Verbindungen, wobei Kationen mit Koordinationszahl 4, Anionen mit Koordinationszahl 6 ausgebildet werden, z. B. [AsOH(OR)3][AsOH(OR)3F2]; bei der Umlagerung in die heteropolare Form erfolgt stets die Übertragung des Fluors und nicht die der anderen Gruppen.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 17
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 328-344 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: From the IR-spectra of gaseous NSF3 and SNF, an assignment of the fundamental vibrations and an estimation of the valence force constants are given.The constitutions of SNF, NSF3, S3N3F3, and S4N4F4 are investigated by NMR-spectra.
    Notes: Es wird versucht, aus den Infrarotspektren der Gase NSF3 und SNF die Struktur der Molekeln abzuleiten. Eine Zuordnung der Grundschwingungen wird vorgenommen und die Berechnung der Valenzkraftkonstanten durchgeführt. [NSF3: fSN = 12,4 msyn/Å (SN-Bindungsgrad = 2,7), fSF = 5,(6) msyn/Å (SF-Bindungsgrad = 1,(2)); SNF: fSN = 10,4 msyn/Å (SN-Bindungsgrad = 2,3) fNF = 1,(5) msyn/Å]. Mittels der KMR-Spektren von SNF, NSF3, S3N3F3 und S4N4F4 werden ebenfalls Aussagen über die Konstitutionen dieser Verbindungen erhalten.
    Additional Material: 10 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 18
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 3-12 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The dipole moments of the compounds N(CH3)2Cl, N(C2H5)2Cl, N(CH3)Cl2, and N(C2H5)Cl2 were determined and the order of magnitude of the NCl3-moment was ascertained. The variations of the N—Cl-binding- and N—CH3-group moments within the series N(CH3)3/N(CH3)2Cl/N(CH3)Cl2/NCl3 resulting from inner molecular induction were estimated for the (+)N—Cl(-) and (-)N—Cl(+) cases. A comparison with the order of magnitude in the corresponding variations of the C—Cl-binding- and C—CH3,-group moments in the alkyl halogenides led to the result that the direction of the N—Cl-binding moment in the compounds investigated is as shown: (+)N—Cl(-).
    Notes: Die Dipolmomente der Verbindungen N(CH3)2Cl, N(C2H5)2Cl, N(CH3)Cl2 und N(C2H5)Cl2 wurden bestimmt und das des Chlorstickstoffs der Größenordnung nach ermittelt. Die Änderungen der N—Cl-Bindungs- und N—CH3-Gruppenmomente innerhalb der Reihe N(CH3)3/N(CH3)2Cl/N(CH3)Cl2/NCl3 infolge innermolekularer Induktion wurden für die Fälle (+)N—Cl(-) und (-) und (-)N—Cl(+) abgeschätzt. Ein Vergleich mit der Größenordnung entsprechender Änderungen der C—Cl-Bindungs- und C—CH3-Gruppenmomente bei Alkylhalogeniden führt zu dem Ergebnis, daß der Richtungssinn des N—Cl-Bindungsmoments in den untersuchten Verbindungen (+)N—Cl(-) ist.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 19
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The reactions of the LEWIS acid SO3, with tertiary phenyl and cyclohexyl derivatives of N, P, As, Sb, and Bi have been studied. According to the sequence: phosphine, bismuthine, arsine, and stibine, especially stable SO3-adducts are formed by the compounds of P and surprisingly of Bi. In the case of As- and Sb-compounds redox reactions occur.Tertiary phosphine and arsine oxides and sulfides, respectively, yield SO3 -adducts, too.
    Notes: Die Reaktionen der LEWIS-Säure. SO3 mit den tertiären Phenyl- und Cyclohexylderivaten von N, P, As, Sb und Bi wurden studiert. Besonders stabile SO3-Addukte bildeten die Verbindungen des Phosphors und überraschenderweise des Wismuts. Die Donatoreigenschaften der Triphenylverbindungen nehmen in folgender Reihe ab: Phosphin, Bismutin, Arsin und Stibin. Den schwächeren LEWIS-Basen gegenüber wirkte SO3 oxydierend, wobei im Falle des Arsins auch dieser Reaktion eine Adduktbildung voran ging. Den SO3-Addukten entsprechen zum Teil stabile BH3-Addukte. Auch die tertiären Phosphin- und Arsin-Oxyde bzw. Sulfide reagierten mit SO3 unter Bildung von Addukten. Die bisher wenig bekannten Donatoreigenschaften dieser Verbindungsklasse wurden damit deutlich gemacht.
    Additional Material: 15 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 20
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 98-104 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Melting sodium oxide even reacts with gold. Crucibles of magnesium oxide only are useful to some extent, but not for thermal analysis of the system NaCl-Na2O. Therefore, the melting phenomena were studied by observing the motion of a heavy piston into the melting material while heating. By this means a eutectic point was found at ∼700 °C and ∼25 mol% Na2O; there is no evidence for the formation of any compound.
    Notes: Schmelzendes Natriumoxid reagiert sogar mit Gold. Als Gefäßmaterial ist nur Magnesiumoxid beschränkt brauchbar, aber die käuflichen Geräte sind nicht zur thermischen Analyse des Systems NaCl-Na2O geeignet. Die Schmelzerscheinungen wurden deshalb dadurch studiert, daß das Eindringen eines belasteten Stempels in das schmelzende Material beim Erhitzen verfolgt wurde. So wurde ein Eutektikum bei ∼700 °C und ∼25 Mol-% Na2O gefunden; Anzeichen für die Existenz einer Verbindung aus den Komponenten ergaben sich nicht.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 21
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 133-142 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Non-electrolytic binuclear complexes of the composition [MeX1{OC3H6N(C2H5)2}1]2 are formed by interaction between 3-N,N-diethyl aminopropanol and Cu- and Zn-halo- genides, respectively. Using 2-N,N-diethyl aminoethanthiol, Zn- and Ni-compounds of the same kind have been prepared. N,N,N′-triethyl ethylene diamine yields ordinary mono- nuclear complexes, [enCuX2], and binuclear compounds. Only mononuclear complexes of copper are formed by N,N-diethyl ethylene diamine.
    Notes: 3-N,N-diäthylaminopropanol bildet ebenso wie das entsprechende Äthanolamin mit Kupfer- bzw. Zinkhalogeniden Zweikernkomplexe [CuX1{OC3H6N(C2H5)2}1]2 von Nichtelektrolytcharakter. Vom 2-N,N-diäthylaminoäthanthiol konnten gleichartige Verbindungen nur mit Zinkhalogeniden und erstmalig auch mit Nickelsalzen erhalten werden. Das N,N,N′-Triäthyläthylendiamin führte entweder zu Einkernkomplexen [en CuX2] der üblichen Art oder bei Überschuß zu Zweikernkomplexen von anderer Zusammensetzung und Konstitution. Das N,N-Diäthyläthylendiamin verhielt sich als Ligand praktisch ebenso wie das unsubstituierte Äthylendiamin und lieferte mit Kupferhalogeniden lediglich Einkernkomplexe.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 22
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 309 (1961), S. 233-244 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: A culminative effect of some factors, which are responsible for the formation of aluminum hydroxide crystals has been observed in experiments treating alkali aluminates by CO2 and aqueous solutions of aluminum salts by alkali.The concentration of the OH-ions, the temperature of the reaction, and the kind of bond of water decide the nature of the precipitation products.The precipitated materials have been identified by X-ray diagrams, phase contrast microscopy, electron microscopy, and IR-spectroscopy.
    Notes: Fällungsversuche mit Aluminatlaugen und wäßrigen Lösungen von Aluminiumsalzen haben das Zusammenwirken einiger Faktoren, die für die Bildung kristalliner Aluminium-trihydroxide verantwortlich sind, erkennen lassen. Die OH--Ionenkonzentration, die Reaktionstemperatur und die Art der Bindung des Wassers bestimmen den Charakter des Fällungsproduktes. Die Identifizierung der ausgefällten Materialien geschah unter Verwendung des Röntgendiffraktometers, der Phasenkontrastmikroskopie, der Elektronenmikroskopie und der Infrarotspektroskopie.
    Additional Material: 5 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 23
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 309 (1961), S. 171-180 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The IR-spectra of the gaseous thionylimides OSNH and OSND and an assignment of the fundamental vibrations are communicated. The compounds have the structure 0—S—N—X with ∢OSN ≈ 120° and ∢SNX = 110° → 130°, X being probably in the OSN-plane. From the SO- and SN-valence force constants (8.7 and 8.3 mdyn/Å, respectively), SO-and SN-bond orders of 1.8 and 1.9 result.
    Notes: Die Infrarotspektren der gasförmigen Thionylimide OSNH und OSND werden mitgeteilt und eine Zuordnung der Grundschwingungen vorgenommen. Die Moleküle besitzen die Struktur O—S—N—X; ∢OSN ≈ 120°; ∢SNX = 110° → 130°; X befindet sich vermutlich in der OSN-Ebene. Ob eine cis- oder trans-Form vorliegt, kann nicht entschieden werden. Die SO- und SN-Valenzkraftkonstanten betragen 8,7 und 8,3 mdyn/Å, daraus ergeben sich die SO- und SN-Bindungsgrade zu 1,8 und 1,9.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 24
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961), S. 212-223 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The RAMAN and IR-spectra of trisulfuryl chloride are observed and discussed. The symmetries belonging to the point groups C2 h and D2 h are excluded by structure considerations. The structures C1, C2, Cs and C2 v are remaining. The stretching frequencies are assigned. It has been found that the stretching frequencies of the (sulfuroxygen)-double bond and the single bond are doubled in consequence of the central SO3 group. The known RAMAN-spectrum of disulfuryl chloride is completed by the infrared spectrum.
    Notes: Die RAMAN- und Ultrarotspektren des Trisulfurylchlorides wurden aufgenommen und diskutiert. Durch Strukturbetrachtungen werden die Symmetrien der Punktgruppen C2 h und D2 h ausgeschlossen. Offen bleiben die Strukturen C1, C2Cs und C2 v. Die Valenzfrequenzen werden zugeordnet. Es zeigt sich, daß sowohl die Zahl der Valenzfrequenzen der Schwefel - Sauerstoff-Doppelbindung als auch die der Einfachbindung infolge der mittelständigen SO3-Gruppe verdoppelt werden. - Das bekannte RAMAN-Spektrum des Disulfurylchlorides wird durch das Ultrarotspektrum ergänzt.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 25
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Experimental examinations of the theorie of d-electron vacancies of metal catalysts have shown that the influence of additive iron in Ni-catalysts is counterbalanced by small amounts of copper. Copper additions of 5% cause an alteration of the catalytic activity of about one order of magnitude.
    Notes: Versuche zur experimentellen Überprüfung der d-Lücken-Theorie der Metallkatalysatoren zeigen, daß der Einfluß von Eisenzusätzen zu Nickel-Katalysatoren durch geringe Kupfersätze aufgehoben werden kann. Kupferzusätze von 5% bewirken eine Änderung der katalytischen Aktivität um etwa eine Größenordnung.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 26
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 143-169 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Compounds of the alkali metals with copper do not exist; only lithium is somewhat soluble in metallic copper. According to literature data silver forms with lithium several intermetallic phases; the phase NaAg2, up to now unknown, was found in the system Na/Ag. Gold forms compounds with all alkali metals. The existance of the following phases could be established by means of thermal analysis: Li15Au4, Li3Au, δ1 and δ2 (∼35 At.-% Au), β′, β′1, and β′2 (between 44.5 and 51%), Li4Au5, α(60-100%), α1 (63-83%), α2 (60%); Na2Au, NaAu, NaAu2; K2Au, KAu, KAu2, KAu4; RbAu, RbAu2, RbAu4; CsAu. The structures of NaAg2, Li15Au4, β′, β′1, β′2, α and α1, furthermore of RbAu and CsAu could be elucidated.The investigated systems show clear correlations; the tendency in forming compounds increases from copper to gold and from caesium to lithium. Broader regions of homogeneity occur only in lithium-containing systems.The volume chemistry of alloys is discussed. In all solid solutions and alloys the alkali metals are strongly contacted; provided that the amount of noble metal is not too small, the “Volume increments in intermetallic compounds” according to W. Biltz can be applied to the alkali metals.
    Notes: Verbindungen der Alkalimetalle mit Kupfer existieren nicht; nur Li löst sich etwas im Cu-Metall. Silber bildet nach Literaturangaben mit Li mehrere intermetallische Phasen; im System Na/Ag wurde die bisher übersehene Phase NaAg2 gefunden. Gold bildet mit allen Alkalimetallen Verbindungen. Durch thermische Analyse wurden folgende Phasen nachgewiesen: Li15Au4, Li3Au, δ1 und δ2 (∼35 At.-% Au), β′, β′1, und β′2 (zwischen 44,5 und 51%), Li4Au5, α (60-100%), α1 (63-83%), α2 (60%). — Na2Au, NaAu, NaAu2 — K2Au, KAu, KAu2, KAu4 — RbAu, RbAu2, RbAu4, — CsAu. Die Strukturen von NaAg2, im System Li/Au von Li15Au4, β′, β′1, β′2, α und α1, ferner von RbAu und CsAu konnten aufgeklärt werden.Die untersuchten Systeme zeigen übersichtliche Verhältnisse; die Tendenz zur Verbindungsbildung steigt vom Kupfer zum Gold und vom Caesium zum Lithium. Breitere Homogenitätsgebiete treten nur bei den Li-haltigen Systemen auf.Die Raumchemie der Legierungen wird besprochen. Bei allen festen Lösungen und Legierungen sind die Alkalimetalle stark kontrahiert; bei nicht zu kleinem Gehalt an Edelmetall finden sich für die Alkalimetalle die „Volumeninkremente in intermetallischen Verbindungen“ nach W. Biltz.
    Additional Material: 20 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 27
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 12-25 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The neutralization-like reactions occuring in the ionizing solvent benzoyl fluoride between acid- and base-like compounds have been investigated by conductometric, potentiometric, and preparative methods. Similarly, replacement reactions between salt-like and strongly basic compounds were studied.From the potentiometric measurements, the maximum value of the ionic product of benzoyl fluoride at 20°C is supposed to be [C6H5CO+][F-] 〈 10-19.
    Notes: Die in dem ionisierenden Solvens Benzoylfluorid aufgefundenen Säuren- und Basenanalogen wurden in neutralisationsanalogen Umsetzungen zu den entsprechenden salzanalogen Verbindungen unter gleichzeitiger Bildung von Solvensmolekülen umgesetzt. Weiterhin wurden zwischen salzanalogen Verbindungen, die sich von einem schwachen Basenanalogen ableiten, und starken Basenanalogen Verdrängungstitrationen durchgeführt. Die Reaktionen wurden konduktometrisch und potentiometrisch verfolgt, teilweise wurden die gebildeten Salzanalogen präparativ dargestellt. Aus dem Verlauf der potentiometrischen Titrationen wurde die obere Grenze des Ionenproduktes des Benzoylfluorides bei 20° zu [C6H5CO+][F-] 〈 10-19 abgeschätzt.
    Additional Material: 18 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 28
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 26-31 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Solutions of GeCl4 in strong HCl (〉6 n) exhibit strong absorption in the UV-region at 2100-2150 Å, proportional to both HCl- and GeCl4-concentration and - at constant acid concentration - according to the Lambert-Beer law.The [GeCl6]2--ion is supposed to be the absorbing species. The molar extinction coefficient and the equilibrium constant of the reaction 2Cl- + GeCl4 ⇄ [GeCl6]2- have been estimated.Alkali chlorides enlarge the absorption efficieny of these solutions. The effect decreases from LiCl to CsCl.
    Notes: Salzsaure Lösungen von Germanium(IV)-chlorid zeigen oberhalb einer Salzsäurekonzentration von 6 n im UV-Gebiet von 2100-2150 Å eine starke Absorption, die sowohl der Salzsäure- als auch Germaniumkonzentration proportional ist. Im untersuchten Germaniumkonzentrationsbereich gilt bei konstanter Säurekonzentration das Lambert-Beersche Gesetz. Da weder eine wäßrige Lösung von GeO2 noch GeCl4 in Methanol unter vergleichbaren Konzentrationsbedingungen eine nennenswerte Absorption aufweisen, wird als absorbierender Körper in salzsaurer Lösung das GeCl62--Ion angenommen. Aus den Meßergebnissen konnte die Gleichgewichtskonstante der Reaktion 2 Cl- + GeCl4 ⇌ GeCl62- sowie der molare Extinktionskoeffizient berechnet werden. Alkalichloride erhöhen das Absorptionsvermögen salzsaurer Lösungen von GeCl4. Der Effekt nimmt innerhalb der Gruppe vom LiCl zum CsCl hin ab.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 29
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 121-122 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 30
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 123-142 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By reaction of (N2H5)2SO4 with NaBH4, hydrazine borine (m. p. 61°C) is obtained in good yields. Solubilities, dipole moment, crystal structure and IR-absorption were studied. In the pyrolysis of this compound, one mole of hydrogen and a part of the hydrazine are released. Under controlled conditions, H2B—NHNH—BH2 can be isolated from the products of pyrolysis in good yields as a crystalline polymeric compound, stable in water and acids. Powder diagrams and IR-spectra were taken. Further pyrolysis leads to instable or even explosive compounds with compositions near (HBN)n which contain still N—N-bonds.
    Notes: Durch Umsetzung von Hydrazinsulfat mit Natriumboranat wird das Monoborinhydrazin in guten Ausbeuten erhalten, Fp. 61°. Löslichkeiten, Dipolmoment, Kristallstruktur und IR-Spektren wurden untersucht. Bei der Pyrolyse wird rasch ein Mol Wasserstoff und ein Teil des Hydrazins abgeben. Aus den Reaktionsprodukten läßt sich unter bestimmten Versuchsbedingungen mit guten Ausbeuten H2B—NH—NH—BH2 isolieren, das als Polymeres vorliegt und gegenüber Wasser und auch Säuren unempfindlich ist. Auch diese Verbindung ist kristallin und wurde durch ihr Debyeogramm und ihr IR-Spektrum charakterisiert. Die weitere Pyrolyse führt zu wenig beständigen, teilweise explosiven Verbindungen der ungefähren Zusammensetzung (HBN)n, in der auch noch die N—N-Bindung des Hydrazins zum größten Teil erhalten ist.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 31
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 1-11 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The physical and solvent properties of benzoyl fluoride, acting as an ionizing solvent for many inorganic and organic compounds, have been investigated. Numerous compounds increase the poor specific self-conductivity of the pure solvent (χ20° = 1 · 10-8 mho cm-1). From the assumed small self-dissoziation of pure benzoyl fluoride according to C6H5COF ⇌ C6H5CO+ + F-, a classification of the soluble compounds is given on the basis of their acid-base-reactions.
    Notes: Im Rahmen von Untersuchungen an ionisierenden Lösungsmitteln wird Benzoylfluorid unter diesem Gesichtspunkt als Lösungsmittel untersucht. Die physikalischen Daten des Benzoylfluorides werden soweit bekannt zusammengestellt und teilweise erstmalig bzw. erneut bestimmt. Es wird ein Überblick über das Lösevermögen des Benzoylfluorides für anorganische und organische Stoffe gegeben. Zahlreiche Substanzen erhöhen beim Lösen in Benzoylfluorid die sehr geringe spezifische Eigenleitfähigkeit des reinen Lösungsmittels von χ20° = 1 · 10-8 ω-1 cm-1 bedeutend. Die spezifischen und molaren Leitfähigkeiten einiger dieser Verbindungen werden bestimmt. Als Ursache der geringen Eigenleitfähigkeit des reinen Benzoylfluorides muß eine sehr geringe Eigendissoziation des Benzoylfluorides nach C6H5COF ⇌ C6H5CO+ + F- angenommen werden. Entsprechend diesem Dissoziationsschema werden die in Benzoylfluorid löslichen Verbindungen in säuren-, basen- und salzanaloge Stoffe sowie in Substanzen, die in das Solvosystem des Benzoylfluorides nicht eingreifen, eingeteilt.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 32
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 32-42 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Symmetric bis-(silyl) hydrazines and monisilyl hydrazines with blocked functions at the neighbouring N-atom react with chlorosilanes only after metallation of a NH-group by LiC6H5, yielding tris- and asymm. bis-(trialkylsilyl) hydrazines, respectively (equations in „Inhaltsübersicht“).
    Notes: Symmetrisch zweifach silylsubstituierte Hydrazine reagieren nicht direkt mit Chlorsilanen, sondern erst nach vorangehender Metallierung einer NH-Gruppe durch Lithium-phenyl: R3SiNHNHSiR3 + LiC6H5 + R′3SiCl → ( R′3Si)(R3Si)NNHSiR3 + LiCl + C6H6.Das gleiche gilt für Monosilylhydrazine mit blockierten Funktionen am benachbarten N-Atom: R′R″NNHSiR3+ LiC6H5 + R3SiCl → R′R″NN(SiR3)2 + LiCl + C6H6.Es konnten so dreifach und asymmetrisch zweifach trialkylsilylsubstituierte Hydrazine bequem dargestellt werden.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 33
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 50-52 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Trimethyl chlorosilane reacts with sodium forming hexamethyl disilane the preparation of which is successful with aluminium chloride as a catalyst and special apparative methods. While t-butyl chloride forms under analogous conditions small amounts of hexamethyl ethane resp., together with trimethylchlorosilane, t-butyltrimethylsilane, experiments for the preparation of octamethyl trisilane have failed.
    Notes: Trimethylchlorsilan reagiert mit Natrium zum Hexamethyldisilan. Die präparative Darstellung gelingt mit Aluminiumchlorid als Katalysator und speziellen apparativen Maßnahmen. Während sich unter gleichen Bedingungen aus t-Butylchlorid geringste Mengen Hexamethyläthan bzw. mit Trimethylchlorsilan t-Butyltrimethylsilan bilden, schlagen Versuche zur Darstellung vom Octamethyltrisilan fehl.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 34
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 43-49 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Complex compounds of the general composition [{(C6H5)2P—P(C6H5)2}2MeX2] the nonelectrolytic character of which has been proved by measuring the conductivities are formed from (C6H5)2P—P(C6H5)2 and anhydrous salts MeX2—NiBr2, PdCl2, CoBr2, CoJ2 — in benzene resp. alcohol. The structural configuration of these complexes is discussed on the basis of molecular weight determinations, magnetic measurements and such of the dipole moments, respectively. CuCl reacts with (C6H5)2P—P(C6H5)2 in the molecular ration 1:1.
    Notes: Tetraphenyldiphosphin reagiert als einzähliger Komplexligand mit wasserfreiem NiBr2, PdCl2, CoBr2, CoJ2 in Toluol, Benzol bzw. Alkohol unter Bildung von Komplexen der allgemeinen Zusammensetzung [{(C6H5)2P—P (C6H5)2}2MeX2]. An Hand magnetischer Untersuchungen, Dipolmoment- und Leitfähigkeitsmessungen ist für [{(C6H5)2P—P (C6H5)2}2NiBr2], [{(C6H5)2P—P (C6H5)2}2PdCl2] u. [{(C6H5)2P—P (C6H5)2}2CoBr2] ein planquadratischer Bau anzunehmen. Das [{(C6H5)2P—P (C6H5)2}2CoJ2] ist auf Grund des magnetischen Verhaltens tetraedrisch konfiguriert. Kupfer(I)-salze setzen sich mit (C6H5)2P—P(C6H5)2 im Mol.-Verh. von 1:1 um. Das (C6H5)2P—P(C6H5)2 · CuCl gleicht hinsichtlich des strukturellen Aufbaues den analogen Kupfer(I)-Komplexen prim., sek. und tert. Phosphine.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 35
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 69-77 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The exchange reactions occurring rapidly and completely between Si—Cl- and Si—N-bonds in dilute benzene solutions have been investigated by dielectric measurements. The direction of exchange depends on the nature of other Si-ligands.
    Notes: Mit Hilfe einer dielektrischen Meßmethode wird gezeigt, daß in verdünnten benzolischen Lösungen bei Zimmertemperatur Austauschreaktionen zwischen SiCl- und SiN-Verbindungen vonstatten gehen, die rasch und völlig nach einer Seite verlaufen. Diese Reaktionen gestatten Aussagen über die nicht unmittelbar am Austausch beteiligten Gruppen.
    Additional Material: 10 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 36
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 53-68 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Several alkali-alkaline-earth-phosphates, -arsenates and -vanadates of the general formula MeIMeIIXVO4 have been prepared by sintering or fusing the respective components. Using the isotypism of these compounds with K2SO4, the lattice constants of the low-temperature (NT-) and high-temperature (HT-) modifications have been determined. The space groups are D2h16 for the NT-forms and D3d3 for the HT-forms.The HT-forms of NaBaPO4, NaSrPO4, NaBaAsO4, and of the vanadates of Sr and Ba are unstable, yielding the tertiary salts Me3IXO4 and Me3II(XO4)2 at higher temperatures.Investigating the behaviour of KSrPO4 and KSrVO4, it has been shown that this type of compounds is hydrolyzed to hydroxyapatites.
    Notes: Durch Sintern oder Schmelzen entsprechender Mischungen der Komponenten werden folgende Alkali-Erdalkaliphosphate, -arsenate und -vanadate hergestellt: Na(K)Ca(Sr, Ba) P(As, V)O4. Ausgehend von der Isotypie des Kaliumsulfates mit derartigen A2XO4-Verbindungen werden deren Gitterkonstanten für die rhombischen Niedertemperatur(NT)-bzw. für die hexagonalen Hochtemperatur(HT)-Formen berechnet. Alle Verbindungen kristallisieren in den Raumgruppen D2h16 bzw. D3d3. Die HT-Formen von NaBaPO4, NaSrAsO4, NaBaAsO4 und der Vanadate des Sr und Ba sind unbeständig. In diesen Fällen tritt beim Erhitzen Zersetzung zu tertiären Salzen Me3IXO4 und Me3II(XO4)2 ein. Der Grund für die Zersetzung kann aus der Feldstärkentheorie von Dietzel hergeleitet werden. - An den Beispielen des KSrPO4 und des KSrVO4 wird gezeigt, daß die Verbindungen durch Wasser zu den entsprechenden Hydroxylapatiten hydrolysiert werden.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 37
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 86-89 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: It is shown that the reaction between molybdenum pentachloride and methanol proceeds in two ways. The resulting compounds are described.
    Notes: Es wird gezeigt, daß die Reaktion zwischen Molybdänpentachlorid und Methylalkohol in zwei Richtungen verlaufen kann. Die Reaktionsprodukte werden beschrieben.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 38
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 78-85 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The dipole moments of some dimethyl aminosilanes are reported. There are considerable deviations from the additivity of constant bond moments, indicating a partial double bond character of the Si—N-bond.
    Notes: Die Dipolmomente einiger Dimethylaminosilanderivate wurden bestimmt. Der Vergleich der Dimethylaminochlorsilane mit den entsprechenden Methylchlorsilanen und Dimethylaminomethylsilanen zeigt bedeutende Abweichungen von der Additivität konstanter Bindungsmomente. Diese Abweichungen werden unter dem Gesichtspunkt der Herausbildung partieller Si—N-Doppelbindungen diskutiert.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 39
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 90-93 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The action of ammonia or amines on disulfuryl fluoride in a molar ratio of 2:1 does not lead to a substitution of fluorine at lower temperatures. The primary step in the reaction is the aminolytic fission of the (S—O—S)-bond. The reaction is suitable for the preparation of the amidosulphuric acid fluoride and its N-alkyl derivatives.
    Notes: Die Einwirkung von Ammoniak oder Aminen auf Disulfurylfluorid im Mol-Verhältnis 2:1 führt bei niederen Temperaturen nicht zu einer Fluor-Substitution. Der primäre Reaktionsschritt ist die ammonolytische Spaltung der S—O—S-Bindung. Die Umsetzung ist zur präparativen Gewinnung des Amidoschwefelsäurefluorids und seiner N-Alkylderivate geeignet.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 40
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 94-99 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The preparation of a number of esters of amidosulphonic acid from amidosulphonic acid chloride and alcoholates is described. The properties and reactions of the esters are communicated.
    Notes: Es wird die Darstellung einiger Ester der Amidoschwefelsäure aus Amidoschwefel-säurechlorid und Alkoholaten beschrieben. Eigenschaften und Reaktionen der Ester werden mitgeteilt.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 41
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 113-113 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 42
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 100-109 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Synthesis and properties of the compounds X(CH3)2SiNHSi(CH3)2X (X = H, C6H5, Cl, and Br) are described. The products of hydrolysis and the relative rate of hydrolysis  -  including that of (CH3)3SiNHSi(CH3)3  -  are studied. The results are discussed regarding bond properties and steric effects.
    Notes: Darstellung und Eigenschaften der Tetramethyldisilazane X(CH3)2SiNHSi(CH3)2X mit X = H, C6H5, Cl und Br werden beschrieben. Insbesondere wurden die Hydrolyseprodukte dieser Stoffe und die relative Hydrolysegeschwindigkeit einschließlich der des (CH3)3SiNHSi(CH3)3 näher studiert. Die Ergebnisse werden in bindungstheoretischer Hinsicht diskutiert.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 43
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 110-113 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The infrared spectra of NaHC2 and Na2C2, prepared by known procedures, were obtained. All the three expected frequencies for NaHC2 could be observed. The force constants were calculated. They show the expected decrease with the increase of lone electron pairs. For Na2C2 no C—C stretching frequency was observed. The compound is easily oxidized to carbonate.
    Notes: Nach bekannten Verfahren wurde Mono- und Di-Natriumacetylid dargestellt und deren Infrarot-Spektren aufgenommen. Bei der Monoverbindung wurden die drei zu erwartenden Frequenzen erhalten und die Kraftkonstanten berechnet. Auch bei diesem Ion bringt die Zunahme freier Elektronenpaare eine Verminderung der Kraftkonstante. In der Dinatriumverbindung konnte die C≡C-Valenzschwingung nicht ermittelt werden. Dagegen wurde leichte Oxydierbarkeit zu Carbonat festgestellt.
    Additional Material: 2 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 44
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 114-120 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Paper chromatography of PO(NH2)3 in liquid NH3 is described, and the RAMAN spectrum of the solid as well as the infrared spectrum of the aquous solution is given together with corrections of former assignments. By comparison of force constants and frequencies it is shown, that phosphorus in PO(NH2)3 and PS(NH2)3 as in a less electro-negative environment uses d-electrons for bonding only to a small degree.
    Notes: Die Papierchromatographie von PO(NH2)3 in flüssigen NH3 wird beschrieben und das RAMAN-Spektrum der festen Substanz sowie das Infrarotspektrum der wäßrigen Lösung mitgeteilt, zusammen mit Berichtigungen einer früheren Zuordnung. Durch Vergleiche von Kraftkonstanten und Frequenzen wird gezeigt, daß d-Elektronen des Phosphors in PO(NH2)3 und in PS(NH2)3 als in einer wenig elektronegativen Umgebung nur in einem geringen Maße an den Bindungen beteiligt sind.
    Additional Material: 2 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 45
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 46
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 185-194 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: From solutions of SrCl2 containing KH2PO4 in excess, well crystallized SrHPO4 is precipitated by KOH at pH = 6-8. At higher pH-values, strontium hydroxy-apatite is obtained. If SrCl2 is in excess, at all pH-values hydroxy-apatite is formed. Alkali chlorides favourise the formation of apatite; in the presence of them, apatite is formed at all pH-values if their concentration is at least 1,5 n.Barium ions form at pH = 6-8 the secondary phosphate, too. At higher pH-values, however, tertiary phosphate is obtained instead of apatite. In the presence of alkali chlorides, barium hydroxy-apatite is precipitated from aqueous solutions only at pH = 10.
    Notes: Aus Strontiumchloridlösungen, die überschüssiges KH2PO4 enthalten, fällt mit KOH be pH 6-8 gut kristallisiertes sekundäres Strontiumphosphat, bei höheren pH-Werten dagegen Strontiumhydroxylapatit. Liegt überschüssiges SrCl2 vor, so entsteht bei allen pH-Werten nur Hydroxylapatit. Alkalichloride begünstigen die Apatitbildung; in ihrer Gegenwart fällt, sofern ihre Konzentration mindestens 1,5 n beträgt, ebenfalls bei allen pH-Werten Apatit aus. - Bariumionen liefern bei pH 6-8 ebenfalls das sekundäre Phosphat, bei höheren pH-Werten jedoch nicht Apatit, sondern das tertiäre Phosphat. Barium-hydroxylapatit wird aus wäßrigen Lösung in Gegenwart von Alkalichloriden erst bei pH 10 ausgefällt.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 47
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 195-203 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Paper chromatography and paper electrophoresis have shown that fluorozirconium and hydroxofluoro zirconium komplexes are easily altered.The easily hydrolyzable pentafluorozirconates have been identified by means of a weakly acid chromatography solvent. Because of the complete dissoziation \documentclass{article}\pagestyle{empty}\begin{document}$$ \left[{{\rm ZrF}_{\rm 7} } \right]^{3 - } \mathbin{\lower.3ex\hbox{$\buildrel\textstyle\rightarrow\over{\smash{\leftarrow}\vphantom{_{\vbox to.5ex{\vss}}}}$}} \left[{{\rm ZrF}_{\rm 6} } \right]^{2 - } + {\rm F}^{\rm - } $$\end{document} occuring during the chromatographic ion separation experiment, only [ZrF6]2-ions are detectable on the chromatogram. Kationic zirconium complexes are formed in strongly acid chromatography solvents.
    Notes: Mit Hilfe von papierchromatographischen und -elektrophoretischen Untersuchungen wird gezeigt, daß Fluorozirkon- und Hydroxofluorozirkon-Komplexe je nach den angewandten Bedingungen sehr leicht Veränderungen unterliegen können. Der Nachweis der leicht hydrolysierenden Pentafluorozirkonate gelingt mit einem schwach sauren Laufmittel. Heptafluorozirkonate dissoziieren wegen der Ionentrennung vollständig nach \documentclass{article}\pagestyle{empty}\begin{document}$$ \left[{{\rm ZrF}_{\rm 7} } \right]^{3 - } \mathbin{\lower.3ex\hbox{$\buildrel\textstyle\rightarrow\over{\smash{\leftarrow}\vphantom{_{\vbox to.5ex{\vss}}}}$}} \left[{{\rm ZrF}_{\rm 6} } \right]^{2 - } + {\rm F}^{\rm - } $$\end{document} so daß nur [ZrF6]2--Ionen auf dem Chromatogramm sichtbar gemacht werden können. Bei Verwendung stark saurer Laufmittel bilden sich kationische Zirkon-Komplexe.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 48
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 204-216 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Acid hydrolysis of K- and [NH4][ZrF5(H2O)] yields K1.5H0.5Zr2F8O and [NH4]1.3H0.7Zr2F8O, respectively. By alkaline hydrolysis of K- and NH4-fluorozirconates, the compounds K- and [NH4][ZrF3(OH)2(H2O)] are formed. These are easily dehydrated to K- and [NH4]ZrF3(OH)2, respectively. It is assumed that in the two latter compounds as well as in KZrF5 and [NH4]ZrF5 zirconium has a higher co-ordination number than 5, resulting from fluorine bridging.The thermal decomposition reactions \documentclass{article}\pagestyle{empty}\begin{document}$ \left[{{\rm NH}_{\rm 4} } \right]{\rm ZrF}_{\rm 3} \left({{\rm OH}} \right)_2 \buildrel \Delta \over \longrightarrow \left[{{\rm NH}_{\rm 4} } \right]_2 {\rm Zr}_{\rm 4} {\rm F}_{{\rm 12}} {\rm O}_{\rm 3} \buildrel { 〉 240^ \circ } \over \longrightarrow {\rm Zr}_{\rm 4} {\rm F}_{{\rm 10}} {\rm O}_{\rm 3} $\end{document} and \documentclass{article}\pagestyle{empty}\begin{document}$$ {\rm KZrF}_{\rm 3} \left({{\rm OH}} \right)_2 \buildrel \Delta \over \longrightarrow {\rm KZrF}_{\rm 3} {\rm O} $$\end{document} yielding still higher molecular compounds are discussed.
    Notes: Durch saure Hydrolyse von Kalium- und Ammoniumpentafluorozirkonatmonohydrat, die mit [ZrF5(H2O)]--Ionen zur formulieren sind, entstehen die Verbindungen K1,5H0,5Zr2F8O bzw. [NH4]1,3H0,7Zr2F8O. Die alkalische Hydrolyse von Kalium- und Ammoniumfluorozirkonaten führt zu den Verbindungen K[ZrF3(OH)2(H2O)] und [NH4][ZrF3(OH)2(H2O)], die sich leicht zu KZrF3(OH)2 bzw. [NH4]ZrF3(OH)2 entwässern lassen. Es ist anzunehmen, daß in den wasserfreien Verbindungen sowie in KZrF5 bzw. [NH4]ZrF5 nicht die Koordinationszahl 5 am Zirkon vorliegt, sondern durch Fluorbrücken eine höhere Koordination erreicht wird. Die thermische Zersetzung von [NH4]ZrF3(OH)2 führt zur [NH4]2 Zr4F12O3, das oberhalb 240° unter [NH4]F-Abspaltung in das definierte Oxyfluorid Zr4F10O3 übergeht. KZrF3(OH)2 liefert bei der thermischen Zersetzung die außerordentlich schwer lösliche Verbindung KZrF3O. Alle nicht in Komplexklammern eingefaßten Anionen-Gruppierungen sind nur als Baueinheiten zu verstehen, die über Fluorbrücken zu höher molekularen Gebilden zusammengefaßt sind.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 49
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 169-179 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Ditertiary phosphines of the type (C6H11)2P—(CH2)n—P(C6H11)2 - with n = 3; 4; 5 - react with anhydrous nickel, cobalt and iron salts forming chelate complexes of the general composition [(C6H11)2P—(CH2)n—P(C6H11)2MeX2] - (Me = Ni, Co, Fe; X = Cl, Br, J, NO3). Whereas the cobalt complexes have a tetrahedral configuration, those of nickel are diamagnetic and have a planar arrangement of ligands. The preparations of [(C6H11)2P—;(CH2)3—P(C6H11)2CuBr] (coordination number of copper = 3) and [(C6H11)2P—(CH2)5—P(C6H11)2Cu2Br2] are described.
    Notes: Die ditertiären Phosphine vom Typ des Trimethylen-1,3-, des Tetramethylen-1,4- und des Pentamethylen-1,5-dicyclohexylphosphins bilden mit wasserfreien Nickel-, Kobalt- und Eisen(II)-Salzen Komplexe der allgemeinen Formel [(C6H11)2P—(CH2)n—P(C6H11)2MeX2], wobei die Liganden mit dem Zentralatom komplexcyclische 6-, 7- und 8-Ringe bilden. Während die Chelatkomplexe des Nickels allgemein planquadratisch konfiguriert sind, weisen diejenigen des Kobalts einen Tetraederbau auf. Die Eisen(II)-Komplexe sind relativ instabil, was eine lockere Koordination der ditertiären Phosphine andeutet, so daß Strukturaussagen auf Grund von Dipolmoment- sowie magnetischen Messungen und Molekulargewichtsbestimmungen nicht möglich sind. Die Kettenlänge zwischen den beiden Phosphoratomen ist nur bei der Bildung der Nickel- und der Kupfer(I)-Komplexe von Einfluß. So vermag (C6H11)2P—(CH2)5—P(C6H11)2 mit NiCl2 das vermutlich trans-konfigurierte [(C6H11)2P—(CH2)5—P(C6H11)2NiCl2] zu bilden. In den analogen Verbindungen des (C6H11)2P—(CH2)3—P(C6H11)2 und des (C6H11)2P—(CH2)4—P(C6H11)2 erfolgt die Fixierung der Liganden in cis-Stellung. Gegenüber Kupfer(I)-bromid verhält sich (C6H11)2P—(CH2)3—P(C6H11)2 als zweizähliger Ligand, wobei eine Substanz der Formel [(C6H11)2P—(CH2)3—P(C6H11)2CuBr] mit koordinativ dreizähligem Kupfer resultiert. Bei entsprechender Reaktion des (C6H11)2P—(CH2)5—P(C6H11)2 entsteht hingegen das [(C6H11)2P—(CH2)5—P(C6H11)2Cu2Br2], und bei Verwendung des (C6H11)2P—(CH2)4—P(C6H11)2 können beide Komplextypen auftreten.
    Additional Material: 2 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 50
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 195-200 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The interaction between S4N4 and diphenyl diazomethane or fluorenyl diazomethane yields bis-diphenyl-methylene trisulfur tetranitride, [(C6H5)2C]2S3N4, and difluorenyliden trisulfur tetranitride, (C13N8)2S3N4, respectively. The preparation methods and the properties of these compounds are described. A reaction mechanism is proposed.
    Notes: Es wurde die Reaktion von S4N4 mit Diazomethanverbindungen untersucht. Die Umsetzung von S4N4 mit Diphenyldiazomethan und Fluorenyldiazomethan führt zu Bisdiphenylmethylen-trischwefel-tetranitrid, [(C6H5)2C]2S3N4, und Difluorenyliden-trischwefeltetranitrid, (C13H8)2S3N4. Herstellung und Eigenschaften dieser Verbindungen sind beschrieben. Für ihre Bildung wird ein Reaktionsmechanismus vorgeschlagen.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 51
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 221-224 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: VICKERY asserts scandium hydroxide to be precipitated very incompletely by an aqueous solution of ammonia. This statement is criticized and in contrast it is shown that using the normal conditions of analytical chemistry the precipitation is quantitative. It has to be supposed that the differing observations of VICKERY are caused by methodic errors which probably explain further improbable results published by the author.
    Notes: Die Behauptung VICKERYS, daß Scandiumhydroxid durch Ammoniaklösung nur sehr unvollständig ausgefällt werde, wird kritisiert. Es wird gezeigt, daß die Fällung bei den üblichen analytisch-chemischen Bedingungen quantitativ erfolgt. Die abweichenden Befunde VICKERYS lassen einen methodischen Fehler vermuten, der wahrscheinlich auch weitere Ergebnisse seiner Arbeit entstellt hat.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 52
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 230-232 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: In den Systemen Hg(CNS)2—KCN—H2O und Hg(CN)2—KCNS—H2O wurden die Verbindungen KHg(CNS)2CN(I), KHg(CN)2CNS(II) und K2Hg(CN)4(III) erhalten. Während I und III nur aus Lösungen bestimmter Zusammensetzung (KCN · Hg(CNS)2) bzw. 4KCN · 4 Hg (CNS)2 erhalten wurden, kristallisiert II aus Reaktionsmischungen mit starker Variation der Komponenten.
    Notes: The compounds KHg(CNS)2CN(I), KHg(CN)2CNS(II) and K2Hg(CN)4(III) have been isolated from the systems: Hg(CNS)2-KCN—H2O and Hg(CN)2—KCNS—H2O. Whereas I and III are obtained from reaction mixtures of the compositions KCN · Hg(CNS)2 and 4 KCN · Hg(CNS)2, II crystallises out from reaction mixtures constituted with large variations of the components.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 53
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The preparation of bis-benzene-chromium(0) in almost theoretical yield is described (one easy catalytic normal-pressure and two room-temperature procedures).The rôle of the aluminium halogenide catalyst forming an intermediate compound of the composition „3[Cr(C6H6)2]AlHal4 · 4 AlHal3“ (with Hal = Cl, Br) has been elucidated.The isolation of this primary complex, its behaviour against ligand exchange, as well as the stability of bis-benzene-chromium(0) and the disproportionation of the [Cr(C6H6)2]+-cation in alkaline solution are communicated.
    Notes: Es werden optimale Bedingungen für die Di-benzol-chrom-Synthese mit fast quantitativer Ausbeute ermittelt, ein bequemes, katalytisches Normaldruckverfahren wird beschrieben und zwei Raumtemperaturverfahren werden angegeben. Es gelingt, die Reaktion in Teilschritte aufzulösen und die Wirkungsweise des Aluminiumhalogenids zu klären. Das Primärprodukt ist „3 [Cr(C6H6)2]AlHal4 · 4 AlHal3“. Es entsteht auch aus Di-benzol-chrom(0) und AlHal3(Hal = Cl, Br) unter Abscheidung von pyrophorem Aluminium.Am Primärkomplex wird ein rascher Ligandenaustausch festgestellt, während Dibenzol-chrom(0) kinetisch bis zu seiner Zersetzungstemperatur völlig stabil ist.Die partielle alkalische Disproportionierung des [Cr(C6H6)2]+-Kations wird beschrieben.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 54
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 277-281 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Cs3TbF7, the first fluoro complex of TbIV, has been prepared. The compound is colourless, relatively stable on exposure to air, and paramagnetic (μ = 7.4 μB). According to the powder diagram, Cs3TbF7 is cubic (a = 9,80 Å; Z = 4 formula units per unit cell; dX-ray = 4.88, dpyk = 4.63 g · cm-3) and probably isotype with (NH4)3ZrF7.
    Notes: Als erster Fluorokomplex des vierwertigen Terbiums wurde Cs3TbF7 erhalten, eine farblose, auch an feuchter Luft recht beständige, paramagnetische (μ = 7,4 μB) Verbindung. Nach Pulveraufnahmen kristallisiert sie kubisch (Z = 4, a = 9,80 Å; drö = 4,88, dpyk = 4,63 g · cm-3), vermutlich im (NH4)3ZrF7-Typ.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 55
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The mixed-crystal systems SnTe—GeTe, SnTe—SnSe, PbSe—SnSe, and GeTe—SnSe are described. Only in the system SnTe—GeTe, complete miscibility occurs; the other systems exhibit miscibility gaps extending to about 40 mole-%. Vegards law is more or less valid.
    Notes: Es werden die Mischkristallsysteme beschrieben: SnTe—GeTe, SnTe—SnSe, PbSe—SnSe, GeTe—SnSe. Im allgemeinen treten Mischungslücken auf über einen Bereich von etwa 40 Mol-%. Nur das heterotype Mischkristallsystem SnTe—GeTe ist lückenlos. Die VEGARDsche Regel ist mehr oder weniger gut erfüllt.
    Additional Material: 8 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 56
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 313 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 57
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 313 (1961), S. 37-47 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: According to the method of Rice, Freamo, and Grelecki solid chloroamine has been decomposed at -190 °C by ultraviolet irradiation. The blue product formed is stable below -150 °C; it is already known from the analogous decomposition of hydrogen azide, and its formation can be understood only by the primary formation of nitrogen monohydride.  -  This result is supported by the identification of hydrogen cyanate during the thermal decomposition of gaseous chloroamine in the presence of carbon mon oxide (5 to 10 Torr, 500 °C). Under the same conditions, hydrazine too produces hydrogen cyanate.  -  Considering the result of Wannagat and Kohnen, who showed nitrogen monohydride and ammonia to form hydrazine, it follows that it is possible to synthesize hydrazine from chloroamine and ammonia via nitrogen monohydride as an intermediate.
    Notes: In Anlehnung an die Methodik von Rice, Freamo und Grelecki wurde festes Chloramin bei -190 °C durch ultraviolette Strahlung zersetzt. Das entstehende blaue Produkt, beständig unterhalb -150 °C, ist bereits durch die entsprechende Zersetzung des Hydrogenazids bekannt; seine Bildung ist nur durch primäres Auftreten von Stickstoffmonohydrid zu erklären.  -  Dieses Ergebnis wird durch den Nachweis von Hydrogencyanat im Anschluß an die thermische Zersetzung gasförmigen Chloramins in Gegenwart von Kohlenmonoxid (5 bis 10 Torr, 500 °C) bekräftigt. Auch Hydrazin liefert unter diesen Bedingungen Hydrogencyanat.  -  Unter Berücksichtigung des Befundes von Wannagat und Kohnen, daß Stickstoffmonohydrid mit Ammoniak zu Hydrazin reagieren kann, folgt, daß es ein experimentell gangbarer Weg ist, Hydrazin aus Chloramin und Ammoniak über Stickstoffmonohydrid als Zwischenprodukt zu synthetisieren.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 58
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 236-241 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The compound [SbCl4][SbF6], being the isomeric ionic form of the fluorination-catalyst SbCl2F3, has been prepared from SbF3 and Cl2.
    Notes: Es wird die aus SbF3 und Cl2 zu gewinnende Verbindung [SbCl4][SbF6] beschrieben, eine heteropolare isomere Form zu der als Fluorierungskatalysator patentierten Substanz SbCl2F3.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 59
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 242-247 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Antimony(V) chloride dissolves in acetonitrile forming the ions [SbCl4]+ and [SbCl6]-. The solvate SbCl5 · CH3CN (mp.: 175°C) is supposed to be the heteropolar compound [SbCl4][SbCl6] · 2 CH3CN.
    Notes: Antimon(V)-chlorid löst sich in Acetonitril unter Ausbildung der komplexen Ionen [SbCl4]+ und [SbCl6]-. Die aus der Lösung abzuscheidende Verbindung SbCl5 · CH3CN sollte, nach dem relativ hohen Schmelzpunkt von 175°C beurteilt, ebenfalls heteropolar gebaut sein und wird als [SbCl4][SbCl6] · 2 CH3CN formuliert.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 60
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 313 (1961), S. 117-120 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By tempering an equimolar mixture of Li2CO3 and α-Al2O3 at 600 °C, a low-temperature form of LiAlO2 is formed (α = 3.38 g · cm-3). Above 600 °C, it is slowly and apparently irreversibly converted to the well-known high-temperature form. The structural relation between high- and low-LiAlO2 is probably similar to that between α- and β-NaFeO2.
    Notes: Beim Tempern eines äquimolaren Gemisches von Li2CO3 und α-Al2O3 bei 600° entsteht eine Tieftemperaturform des LiAlO2 mit der Dichte 3,38 g · cm-3, die sich oberhalb 600°C langsam und anscheinend irreversibel in die bekannte Hochtemperaturform umlagert. T- und H-LiAlO2 stehen wahrscheinlich im gleichen Verhältnis zueinander wie α- und β-NaFeO2.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 61
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 313 (1961), S. 138-143 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Procedures are described for the easy preparation of POCl2Br, POClBr2, PSCl2Br, and PSClBr2 with good yields and high putiries. An improved method is given for PSBr3. The IR-spectra of these compounds were taken and discussed.
    Notes: Ein Verfahren zur bequemen Darstellung von POCl2Br, POClBr2, PSCl2Br und PSClBr2 in guter Ausbeute und Reinheit wird beschrieben und eine vereinfachte Darstellungsvorschrift für PSBr3 angegeben. Die IR-Spektren der genannten Verbindungen werden diskutiert.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 62
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 313 (1961), S. 154-160 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By fluorination of mixtures MICl/CeO2, the colourless, diamagnetic compounds M3CeF7 (M = Na, Rb, Cs) and M2CeF6 (M = Na, K, Rb, Cs) have been obtained. Na3CeF7 cristallizes tetragonal (a = 5.45 Å, c = 10.80 Å, Z = 2), being isotyp with Na3UF7; Cs3CeF7 and Rb3CeF7 are cubic (a = 9.93 resp. 9.52 Å, Z = 4).
    Notes: Durch Fluorierung geeigneter Mischungen MICl/CeO2 wurden die farblosen, diamagnetischen Verbindungen M3CeF7 (M = Na, Rb, Cs) und M2CeF6 (M = Na, K, Rb, Cs) erhalten. Na3CeF7 kristallisiert tetragonal (a = 5,45 Å, c = 10,80 Å, Z = 2) im Na3UF7-Typ, Cs3CeF7 und Rb3CeF7 kubisch (a = 9,93 bzw. 9,52 Å, Z = 4).
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 63
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 338-340 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Das kürzlich von Borchert und Röder vorgeschlagene Phasenschema zur Polymorphie des Calciumcarbids wird diskutiert. Die vom Verfasser bereits 1942 vertretenen Ansichten über die CaC2-Modifikationen werden dabei aufrechterhalten.Eine Neubestimmung der Gitterkonstanten der kubischen Phase IV ergab den Wert 5,880 ± 0,005 Å (bei t = 447 ± 2 °C); der Umwandlungspunkt liegt bei t = 450 ± 2 °C.
    Notes: The writer's original views (1942) on the polymorphism of calcium carbide are upheld in his discussion of a different phase scheme recently proposed by BORCHERT and RÖDER.The lattice constant of the cubic phase, IV, is newly determined as 5,880 ± 0,005 Å at 477 ± 2 °C, and its transition temperature is 450 ± 2 °C.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 64
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961), S. 1-12 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The stability constants of different Me(II)-triphosphate complexes occuring simultaneously in solution can be derived from potentiometric titrations. The apparatus used and the procedure of calculation are described. Stability constants of Zn-, Cd-, and Cu-complexes with triphosphate are given for several pH-values.
    Notes: Es wird gezeigt, wie aus potentiometrischen Titrationskurven die Komplexbildungskonstanten verschiedener in Lösung nebeneinander vorliegender Me(II)-Triphosphat-komplexe bestimmt werden können. Nach einer Beschreibung der verwendeten Meßanordnung wird die rechnerische Auswertung der Titrationskurven dargelegt. Abschließend werden die ermittelten Komplexbildungskonstanten der Triphosphatkomplexe des Zinks, Cadmiums und Kupfers bei verschiedenen pH-Werten angegeben.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 65
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961), S. 13-21 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Me—O-bonds, as in polyphosphate complexes, are discussed in detail for terminal and intermediate PO4-tetrahedra of polyphosphate chains. The stability of the Me—O-bond depends mainly on the number of free corners of the PO4-tetrahedron in the complex.
    Notes: Es werden die Me—O-Bindungen, wie sie in Metall-Polyphosphatkomplexen auftreten, an endständigen und mittelständigen PO4-Tetraedern von Polyphosphatketten näher diskutiert. Es zeigt sich, daß die Stabilität einer solchen Me—O-Bindung vorwiegend davon abhängt, wieviele freie Ecken ein PO4-Tetraeder in einem Metall-Polyphosphat-komplex noch aufzuweisen hat.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 66
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961), S. 102-109 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The IR- and RAMANspectra of Na2S2O7 and K2S2O7 are reported. A structure belonging to the point group C2v is deduced for the ion S2O7″ using the selection rules. Most of the observed frequencies can be assigned to the normal vibrations. Bond orders of 1.70 for the S—O-bond in the SO3-groups and 0.79 resp. 0.83 for the S—O-bond in the S—O—S-chain are calculated by means of the formula of Siebert.
    Notes: Aus den IR- und RAMAN-Spektren von Na2S2O7 und K2S2O7 wird mit Hilfe der Auswahlregeln für das S2O7″-Ion eine Struktur der Punktgruppe C2v abgeleitet. Die beobachteten Frequenzen lassen sich größtenteils den Normalschwingungen zuordnen. Aus den erhaltenen Kraftkonstanten errechnet sich nach den von Siebert angegebenen Formeln für die SO-Bindung in den SO3-Gruppen ein Bindungsgrad von 1,70. Der Bindungsgrad der SO-Brückenbindung beträgt je nach Kraftkonstantenansatz 0,79 bzw. 0,83.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 67
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961), S. 97-101 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The preparation and properties of tetra-β-styrylsilan are described. The heat of formation has been determined to be — 161,5 kcal/mole.
    Notes: Die Darstellung und Eigenschaften von Tetra-β-styrylsilan werden beschrieben. Die Bildungswärme wurde zu — 161,5 kcal/mol bestimmt.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 68
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961), S. 110-116 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Phosphorous tricyanide was prepared by the reaction of silver cyanide with phosphorous chloride. The infrared and RAMAN spectra are recorded. The observed bands are concordant with a trigonal pyramide (C3v). The behaviour against moisture and the decomposition in contact with air is studied.
    Notes: Phosphortricyanid wurde aus Silbercyanid und Phosphortrichlorid dargestellt und das Infrarot- und RAMAN-Spektrum aufgenommen. Die beobachteten Banden lassen sich den Schwingungen einer trigonalen Pyramide zuordnen. Das Verhalten gegenüber Luftfeuchtigkeit und bei der Zersetzung an der Luft wurde untersucht.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 69
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961), S. 117-120 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: A simple preparation of anhydrous hydrazine (with a purity of 99.8%) by high-vacuum recondensation over BaO is described.
    Notes: Es wird eine einfache Methode zur Darstellung kleiner Mengen wasserfreien Hydrazins in der Hochvakuum-Apparatur beschrieben.Die einfache und gefahrlose Umkondensation der nach Penneman und Audrieth(2) aus Hydrazinhydrat und Natriumhydroxid leicht zugänglichen, 92,7 Gewichtsprozent Hydrazin enthaltenden flüssigen Phase über Bariumoxid in der Hochvakuum-Apparatur ergibt mit 90proz. Ausbeute mindestens 99,8proz. Hydrazin.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 70
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 71
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961), S. 121-126 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Transference measurements have shown that the transition of ethoxy-chloroantimony(V) compounds from the homopolar into the heteropolar form is accompanied by a transition of chloride ions from one molecule to another one. The equivalent conductivities and dissoziation constants of the heteropolar compounds are compared among one another and with those of [SbCl4][SbCl6].A brief survey on the complicated reactions of these compounds occurring in AsCl3 is given.
    Notes: Durch Überführungsmessungen wird bestätigt, daß bei der Umwandlung von Chloroantimon(V)-äthoxyverbindungen aus der molekularen in die heteropolare Form Chloridionen von einer Molekel zur anderen übergehen. Äquivalentleitfähigkeiten und Dissoziationskonstanten der heteropolaren Verbindungen werden untereinander und mit den entsprechenden Werten von [SbCl4][SbCl6] verglichen. Die komplizierten Reaktionen der Chloroantimon(V)-äthoxyverbindungen in AsCl3 werden übersichtsmäßig beschrieben.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 72
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 52-61 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: It was not possible to prepare compounds of niobium from niobium oxides and niobium nitrides or nitrogen which contain both oxygen and nitrogen and may be considered as oxonitrides. Only the cubic δ-niobium nitride phase NbN absorbs small amounts of oxygen. Real oxonitrides of niobium are formed, however, if Nb2O5 reacts with NH3 at about 760°C. They have crystal lattices similar to cubic δ-NbN or hexagonal ∊-NbN. They are not very stable and decompose when heated to 1000°C.
    Notes: Es gelang nicht, durch Umsetzung von Nioboxyden mit Niobnitriden oder mit Stickstoff Verbindungen des Niobs darzustellen, die als Oxonitride gleichzeitig Sauerstoff und Stickstoff enthalten. Lediglich die kubische δ-Niobnitridphase NbN vermag kleine Mengen Sauerstoff zusätzlich aufzunehmen. Echte Oxonitride des Niobs entstehen jedoch bei der Umsetzung von Nb2O5 mit NH3 bei etwa 750°C. Sie besitzen ähnliche Kristallgitter wie kubisches δ-NbN oder hexagonales ∊-NbN. Sie sind nicht sehr stabil und zersetzen sich beim Erhitzen auf 1000°C.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 73
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 91-97 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Formation of mixed crystals was found in the system LiCl/TiCl2. The phase diagram of the system RbCl/TiCl2 shows the existence of the congruently (at 852 °C) melting compound RbTiCl3 and the incongruently (at 732 °C) melting compound Rb2TiCl4. In the system CsCl/TiCl2 the corresponding compounds CsTiCl3 (m. p. 932 °C) and CsTiCl3 (m. p. 747 °C) were found.
    Notes: Im System LiCl/TiCl2 wurde Mischkristallbildung festgestellt. Im System RbCl/TiCl2 existieren die kongruent bei 852 °C schmelzende Verbindung RbTiCl3 und die bei 732 °C inkongruent schmelzende Verbindung Rb2TiCl4. Im System CsCl/TiCl2 wurden die Verbindungen CsTiCl3 (Schmp. 932 °C) und Cs2TiCl4 (Schmp. 747 °C inkongruent) gefunden.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 74
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 105-121 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: HBr, HCl, HF cleave C5H5SiH3, (in the absence of a solvent and catalyst; low tem- perature) according to C6H5SiH3 + HX → C6H6 + SiH3X. HCl reacts slowly. In the presence of Cu-salts, HF fluorinates the Si-H groups and no cleavage occurs.The results of the investigation of the cleavage reaction with derivates of C6H5SiH3 indicate that the stability of the silicon-phenyl bond is reinforced by the introduction of negative substituents attached to silicon. Increasing reactivity of the silicon-phenyl bond corresponds to decreasing electronegativities of the substituents. This trend is confirmed by the reactions of bromine and iodine. Cl2 and Br2 easily react pith C6H5SiH3 and its derivates containing Si-H bonds to give phenyltrihalogenosilanes; thus no silicon-phenyl bond cleavage occurs. The reaction of iodine with Si-H groups proceeds less readily. Together with the iodination, a cleavage of the silicon-phenyl bond is caused by HI resulting from iodination of the Si-H group.
    Notes: HBr, HCl, HF spalten, wie auch HJ1), das C6H5SiH3 (ohne Lösungsmittel, ohne Katalysator, niedrige Temp.) nach C6H5SiH3 + HX → C6H6 + SiH3X. HCl reagiert nur langsam. In Gegenwart von Cu-Salzen fluoriert HF die SiH-Gruppen, ohne zu spalten.In SiH-substituierten Derivaten des C6H5SiH3 erfolgt die Spaltung in Benzol und das Siliciumhalogenid um so langsamer, je negativer die Substituenten am Silicium werden, und bleibt schließlich ganz aus. Die sich danach ergebende Reihe der Phenylsilane entspricht der Anordnung nach steigender Elektronegativität. Die Einführung negativer Substituenten am Silicium erhöht die Beständigkeit der Si-Phenyl-Gruppe. Dies wird durch Reaktionen mit Chlor, Brom und Jod bestätigt. Mit Chlor und Brom werden die SiH-Gruppen leicht vollständig halogeniert, so daß dann die Spaltung ausbleibt. Die Jodierung erfolgt schwerer, so daß der gebildete HJ eine Spaltung in Benzol und ein SiH-haltiges Siliciumjodid bewirkt.
    Additional Material: 9 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 75
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 143-154 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Using four different kaolins and one typical clay, reliable values for the crystal-platelet thickness have been estimated from surface area measurements (by N2 and phenol adsorption) and from the particle diameter as observed in the electron micro-scope. The data correspond well with the exchange reactions OH- vs. F- and H2O vs. NH3 as investigated by ARMIN WISS. If it is assumed that all exchangeable cations are situated on only one external tetrahedron layer a relatively dense packing (1.3-1.8 equiv./4G Å2) results.The consequences of substitution of Si by Al only in the outermost tetrahedron layers are discussed with respect to the natural formation of kaolinite.Analogous measurements have shown that the metahalloysite needles are hollow.
    Notes: Durch Messung der Oberfläche aus der Adsorption von N2 und von Phenol und durch Messung der Durchmesser im Elektronenmikroskop gelang es erstmals, zuverlässige Werte für die Dicke der Kristallplättchen von vier Kaolinen verschiedener Feinheit und von einem typischen Ton zu erhalten. Die Werte stimmen gut mit dem Anionenaustausch OH- gegen F- und dem Molekelaustausch H2O gegen NH3 nach ARMIN WEISS überein. Für die austauschfähigen Kationen ergibt sich allerdings eine recht hohe Dichte von 1,3 bis 1,8 Äquivalenten pro 46 Å2, wenn man alle Kationen auf der von einer Tetraederschicht gebildeten äußeren Basisfläche unterbringt.Die aus einem diadochen Ersatz in der äußersten Tetraederschicht folgenden Konsequenzen für die Bildung der Kaolinitkristalle in der Natur werden diskutiert.Für Metahalloysit ergab sich aus den analogen Messungen, daß die Nadeln hohl sind.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 76
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 155-158 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Potassium and sodium salts of tetrafluorotungstic acid, H2[WO2F4], were prepared. By means of salt-cryoskopic measurements in the system H2O/KNO3, evidence is given for the presence of a unimolecular potassium tetrafluorotungstate in weakly acid solutions. This proves that the substitution of oxygen ions by fluoride ions in tungstate anions prevents the aggregation of tungstic acid to higher molecular polytungstic acid.
    Notes: Es werden Kalium- und Natriumsalze der Tetrafluorowolframsäure H2[WO2F4] dargestellt. Salzkryoskopische Untersuchungen an der Kaliumverbindung - K2[WO2F4] - im System H2O/KNO3 ergeben, daß dieses Kaliumtetrafluorowolframat in schwach saurer Lösung monomolekular gelöst vorliegt. Daraus folgt, daß beim Ersatz von Sauerstoffionen durch Fluoridionen im Wolframatanion die Fähigkeit der Wolframsäure, zu höhermolekularen Polywolframsäuren zu aggregieren, verloren geht.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 77
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 190-199 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Two different methods have been employed for the investigation of the system silica/ solutions of Al-chloride:1. The application of solutions with great differences in the degree of hydrolysis. These solutions were prepared by addition of HCl or NaOH to AlCl3 the proportions AlCl3: HCl extending from 1 : 0 to 1 : 1 and AlCl3: KaOH from 1 : 2 to 1 : 1, or by dissolution of Al-metal in acid with the proportions Al: HCl from 1: 2 to 1: 1.2. The application of both closed systems and of open systems (i. e. columns of silica through which the solutions run down.)Measurements of the adsorption for Al and Cl as well as measurements of the changes of pH in the solutions during the adsorption are in accord with equations in which the adsorption of Al on silica is followed by the reactions of HCl with the dissolved compounds. As a consequence of these reactions, the measurements of the adsorption are influenced by hydrolytic processes in solutions of Al-chloride. Evidence for primary and secondary products of the hydrolysis has been obtained.
    Notes: Zwei experimentelle Maßnahmen erleichtern die Aufklärung von Teilreaktionen im System Silicagel/Al-Chloridlösungen:1. Die Anwendung von Al-Chloridlösungen, in denen große Unterschiede des Hydrolysegrades verwirklicht sind. (Solche Lösungen wurden hergestellt durch Zusätze von Säure oder Lauge in den Molverhältnissen AlCl3:HCl = 1:0 bis 1:l und AlCl3,:NaOH = 1 :0 bis 1 : 2, außerdem durch Auflösung von Al-Metall in Säure in den Molverhältnissen Al:HCl = 1 : 2 bis 1:1)2. Die gleichzeitige Anwendung von geschlossenen Systemen (Silicagel als Boden- Körper + überstehende Losung) und von offenen Systemen (Silicagel als Gerüstsubstanz einer Säule + durchfließende Losung).Gemessen wurden die Adsorption der Komponenten A1 und C1 an Silicagel und die damit verbundenen pH-Änderungen in den Lösungen. Die analytischen Ergebnisse lassen sich mit dem Reaktionsschema der sogenannten hydrolytischen Adsorption beschreiben. Die Komponente A1 wird (als Kation oder als Hydrolyseprodukt des Kations) praktisch chloridfrei adsorbiert, dabei wird Saure frei. Diese setzt sich mit den noch gelosten Ver- bindungen um. Als Folge dieser Umsetzungen der Säure sprechen Messungen der pH- abhängigen Adsorption von Al an Silicagel empfindlich auf Hydrolysevorgänge in den Al- Chloridlösungen an. Sie lassen auch die Überlagerung primärer (schnellverlaufender) und sekundärer (zeit- und konzentrationsabhängiger) Vorgänge bei der Hydrolyse der gelösten Verbindungen erkennen.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 78
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: It is shown that the barium silicate hydrate BaO · SiO2 · 6 H2O probably has not the constitution Ba [H2SiO4] · 5 H2O assumed so far, but the constitution HO Ba [H3SiO4] · 4 H2O. This is concluded from the examination of the solubility of the silicate in various solutions of salts and bases. Moreover, the electrolytic dissociation of barium hydroxide is examined and it is ascertained that in its solutions predominantly (BaOH)+ ions are present, which are influencing the solubility of the barium silicate hydrate. Solutions essentially containing (BaOH)+ and (H3SiO4)- ions are in equilibrium with the precipitate.
    Notes: Aus der Untersuchung der Löslichkeit in verschiedenen Salz- und Basenlösungen wird geschlossen, daß dem Bariumsilicathydrat BaO · SiO2 · 6 H2O sehr wahrscheinlich nicht die bisher angenommene Konstitution Ba[H2SiO4] · 5 H2O, sondern die Konstitution HOBa [H3SiO4] · 4 H2O zukommt. Außerdem wird die elektrolytische Dissoziation des Bariumhydroxyds untersucht und dabei festgestellt, daß in seinen Lösungen vorwiegend (BaOH)+-Ionen vorliegen. Diese sind es, die die Löslichkeit des Bariumsilicathydrates beeinflussen. Mit dem Bodenkörper sind Lösungen im Gleichgewicht, die im wesentlichen (BaOH)+- und (H3SiO4)--Ionen enthalten.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 79
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: If Na14CN is prepared by the JEANES-method sometimes the yield of cyanide related to Ba14CO3 summounts 100%. It has been shown that, at higher temperatures additional HCN is produced by the action of NH3 on the iron wire catalyst, containing carbon.The process has been investigated with a Fc—C-alloy containing 3,78% C. The reaction begins at 350°C. At 850 °C, it is possible to transform up to 75% of the carbide carbon into HCN.
    Notes: Bei der Darstellung von Na14CN nach dem Verfahren von JEANES macht sich ein Kohlenstoffgehalt des als Katalysator verwendeten Eisens im analytisch ermittelten Cyanidwert bemerkbar. Als Ursache hierfür wird die Bildung von Blausäure bei der Einwirkung von Ammoniak auf kohlenstoffhaltiges Eisen bei erhöhter Temperatur erkannt.Untersuchungen an einer Fe—C-Legierung mit 3,78% C ergaben. daß die Umsetzung mit NH3 bei etwa 350° beginnt. Bei 850° lassen sich bis zu 75% des gebundenen Kohlenstoffs zu HCN umsetzen.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 80
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 295-304 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Pure alkaline-earth chromates(V), Sr3(CrO4)2 and Ba3(CrO4)2 have been prepared by thermal decomposition of suitable mixtures between the corresponding chromates(VI) and carbonates, hydroxides or oxides at 1000 °C in N2,-atmosphere.The existence of Ca3(CrO4) has been confirmed.In the presence of H2O-vapour, hydroxy-apatites, Me6II (CrVO4)3OH, are formed.The properties of these new compounds and the results of X-ray and magnetochemical investigations are communicated.
    Notes: Die Erdalkalichromate(V) Sr3(CrO4)2 und Ba3(CrO4)2 erhält man in sehr reiner Form durch thermischen Abbau der Gemische der Erdalkalichromate(VI) mit der berechneten Menge Erdalkalicarbonat, -hydroxyd oder -oxyd bei etwa 1000 °C im N2-Strom; sie können zusätzlich 0,15-0,3 Mol Erdalkalioxyd in das Gitter aufnehmen. Die Existenz des entsprechenden Tricalciumchromats(V) wird sichergestellt. Arbeitet man in einem mit Wasserdampf beladenen N2-Strom mit Basenüberschuß, so erhält man nach der Extraktion der thermischen Reaktionsprodukte mit CH3OH Verbindungen vom Typus des Hydroxylapatits Sr10(Ba10)(PO4)6(OH)2.Die Eigenschaften der neuen Verbindungen und die Ergebnisse der röntgenographischen und magnetochemischen Untersuchung werden mitgeteilt.
    Additional Material: 4 Tab.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 81
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 159-178 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Ternary phosphides and arsenides of the compositions Li8-xMnXP4 and Li8-x MnxAs4 with manganese in the oxydation states from II to VII have been thermally prepared.Typical compounds are: Li7MnVP4, Li6.67Mn1.33IVP4, Li6Mn2IIIP4, Li5.5Mn2.5P4; Li7.33Mn0.67VIIAs4, Li7MnVAs4, and Li6Mn2IIIAs4.The crystal structures and phase boundaries are communicated.
    Notes: 1. Es wurden Präparate der Zusammensetzung Li8-xMnxP4 bzw. Li8-xMnxAs4 bei 800 °C bzw. 750 °C mit nachfolgendem Abschrecken hergestellt. Die mittlere Oxydationsstufe des Mangans wurde zwischen 2 und 7 variiert.2. Das Phosphid der höchstmöglichen Oxydationsstufe des Mangans (5+) Li7MnP4 kristallisiert mit statistischer Verteilung der Kationen im Antifluoritgitter mit a = 5,977Å. In der Verbindung kann Lithium durch Mangan bis zur Zusammensetzung Li6,67Mn1,33P4 unter Erniedrigung der mittleren Oxydationsstufe auf 4+ und Ausbildung eines pseudokubischen Gitters mit a = 5,950 Å ersetzt werden.3. Die für eine zweite Mischkristallreihe maßgebende Verbindung Li6Mn2P4 kristallisiert tetragonal, D4h7, a = 5,888 Å, c/a = 1,016. Die Manganatome befinden sich in jeder zweiten zur c-Achse senkrechten Kationen-Gitterebene. Mit sinkendem-Mangangehalt wird das pseudokubische Li6,67Mn1,33P4 erreicht, mit steigendem Mangangehalt das ebenfalls tetragonal kristallisierende Li5,5Mn2,5P4.4. Das Arsenid der höchsten Oxydationsstufe des Mangans (7+) Li7,33Mn0,67As4 kristallisiert mit Lithium und Mangan in statistischer Verteilung im Antifluoritgitter mit a = 6,152 Å. Mit Li3As bildet die Verbindung Mischkristalle mit Lithium auf Zwischengitterplätzen. Ferner kann Lithium durch Mangan bis Li7,2Mn0,8As4 unter Beibehaltung des Fluoritgitters ersetzt werden.5. Ein zweites Einphasengebiet reicht von Li7MnAs4 bis Li6,5Mn1,5As4. Das Li7MnAs4 kristallisiert tetragonal, D4h10, a = 6,166 Å, c/a = 0,982. Die Mangantome sind parallel zur c-Achse mit x = ½ und y = ½ angeordnet.6. Ein drittes Mischkristallgebiet reicht von Li6,4Mn1,6As4 bis Li5,5Mn2,5As4. Der Aufbau, charakterisiert durch Li6Mn2As4 (a = 6,049 Å, c/a = 1,020), stimmt mit dem von Li6Mn2P4 überein.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 82
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The RAMAN and IR-spectra of (CH3)SnH, (CH3),SnF, (CH3)3SnCl and (CH3)3SnBr are measured in various states of aggregation. The frequencies are assigned (symmetry C3v). Contrary to the other compounds, (CH3)3SnF forms an ion lattice. The other halides associate building (Sn-hal-Sn)-bridges. AU halides dissociate in water forming [(CH3)3Sn]+ and halide ions. Force constants are calculated for (CH3)3 SnH and (CH3)3SnCl.
    Notes: Die RAMAN- und IR-Spektren von (CH3)3SnH, (CH3)3 SnF, (CH3)3 SnCl und (CH3)3SnBr in verschiedenen Aggregatzuständen werden mitgeteilt und die Frequenzen den einzelnen Normalschwingungen zugeordnet (Symmetrie C3v). (CH3)3SnF bildet im Gegensatz zu den anderen Verbindungen ein Ionengitter. Die übrigen Halogenide assoziieren über (Sn—Hal—Sn)-Brücken. In wäßrigen Lösungen dissoziieren alle Halogenide in [(CH3)3Sn]+ und Hal′-Ionen. Fur (CH3),SnH und (CH3)3 SnCl wurden Kraftkonstanten berechnet.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 83
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 263-273 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Reducing [Ni(NH3)6](NO3)2 in liquid NH3 by elemental Na, K or Ca, highly dispersed Ni-metal admixed with the hydroxide of the respective reducing agent has been prepared.The catalytic activity of the products formed by Na and K is small. The products obtained by Ca-reduction, however, are excellent catalysts for the hydrogenation of benzene; they contain highly dispersed Ni on a Ca(OH)2-carrier.
    Notes: Durch Reduktion von [Ni(NH3)6](NO3)2O mittels Na, K oder Ca in flüssigem NH3 entsteht hochdisperses Ni-Metall, dem Hydroxyde der Reduktionsmetalle beigemengt sind. Die katalytische Aktivität der mit Na und K reduzierten Präparate ist gering, jedoch besitzen die mit Ca reduzierten Produkte eine ausgezeichnete katalytische Aktivität gegenüber der Benzolhydrierung; sië enthalten hochdisperses Ni auf einem Träger von Ca(OH)2.
    Additional Material: 8 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 84
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 290-294 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By combustion of elemental tellurium in a calorimetric bomb, the enthalpy of formation of TeO2 has been determined to be ΔH298 = -76.9 ± 1.2 kcal/mole.
    Notes: Durch Verbrennung von Tellur in der Bombe wurde calorimetrisch die Bildungsenthalpie des TeO2 zu ΔH298 = -76,9 ± 1.2 kcal/Mol ermittelt.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 85
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 305-313 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: In contrast with the behaviour of nitro compounds, nitrito complexes react with hydrazoic acid yielding N2, N2O and the corresponding aquo complexes.The rate constants of the bimolecular interaction between [(NH3)5CoONO]Cl2 and HN3, and of the simultaneous isomerization to the nitro compound have been determined.
    Notes: Nitritokomplexe lassen sich zum Unterschied von den Nitroverbindungen mit Stickstoffwasserstoffsäure in schwach saurer Lösung unter Entwicklung von Stickstoff und Distickstoffmonoxyd zu den entsprechenden Aquokomplexen umsetzen. Die Kinetik dieser Reaktion wurde am Beispiel des Nitritokobalt(III)-chlorids untersucht. Durch Beobachtung des zeitlichen Ablaufes der Gasentwicklung konnte ermittelt werden, daß es sich hier um eine bimolekulare Reaktion zwischen dem Komplexion und der Stickstoffwasserstoffsäuremolekel handelt, die von der Isomerisierung zum Nitrokomplex begleitet ist. Die Geschwindigkeitskonstanten beider Parallelreaktionen können simultan bestimmt werden.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 86
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 72-78 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Anhydrous amorphous white tin(IV)oxidechloride, SnOCl2, can be obtained by the reaction of C12O with SnCl2, with good yields. SnOCl2, is a very hygroscopic solid, it is insoluble in nonpolar solvents. From POCl3, the addition compound SnOC12 · 2 POCl3 cristallizes; with dry pyridine, SnOCl2 · 1,5 pyridine can be prepared. The IR-spectra are discussed.
    Notes: Bei der Umsetzung von gasförmigem Dichlormonoxid mit Zinntetrachlorid bei Raumtemperatur entsteht in guter Ausbeute wasserfreies Zinn(IV)-Oxidchlorid, SnOCl2. Die Verbindung ist ein weißer, amorpher, sehr hygroskopischer Stoff, der in unpolaren Lösungsmitteln sehr schwer löslich ist. Aus der Lösung in POCl3 kristallisiert die Verbindung SnOCl2 · 2 POCl3, während mit wasserfreiem Pyridin die Additionsverbindung SnOCl2 · 1,5 Pyridin entsteht. Die IR-Spektren werden diskutiert.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 87
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 309 (1961), S. 258-265 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Die Reaktion zwischen Phenoxybromsilanen und metallischem Natrium wurde untersucht, um Analogien zu entsprechenden Reaktionen der Phenoxychlorsilane aufzufinden. Die Versuchsbedingungen waren die gleichen wie bei THOMPSON und KIPPING1. Es wurden aber andere Endprodukte erhalten als von den erwähnten Autoren. Neben Tetraphenoxysilan, Natriumbromid und Silicium wurde Natriumphenolat und jeweils eine Verbindung mit Si—Si-Gruppierung gefunden.Auf Grund der experimentellen Ergebnisse und der Resultate der Analysen der Endprodukte wird ein neuer Reaktionsmechanismus vorgeschlagen.Ein genaues und schnelles Analysenverfahren ist ausgearbeitet worden, das die gleichzeitige Bestimmung aller Komponenten ermöglicht.
    Notes: A study of the reactions between phenoxybromosilanes and metallic sodium has been made with the aim to find analogy with corresponding reactions of phenoxychlorosilanes. The experiments were accomplished under the same conditions as those described by THOMPSON and KIPPING1 for analogous reactions of phenoxychlorosilanes. It has been found, however, that the final products were not similar to those found by the two authors. Besides tetraphenoxysilane, sodium bromide and free silicon sodium phenolate was found among the products in each case and occasionally compounds having Si—Si bond.On the ground of experimental data as well as the results of analyses of the obtained prodcuts a new mechanism for these reactions has been suggested.A new simple and convenient procedure for analysis of the reaction product has been developed, allowing for simultaneous determination of all constituents of the insoluble residue.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 88
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 309 (1961), S. 283-288 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Yellow diamagnetic K2[HCo(CN)5NO] has been prepared from [Co(NH3)5NO]Cl2 (according t o the first equation in „Inhaltsübersicht“) and investigated by salt cryoscopy. Reaction with concentrated aqueous KOH yields crystalline diamagnetic K3[Co(CN)5NO] · 2H2O. In aqueous solution there is following protolysis reaction: [Co(CN)5NO]3- + H2O ⇆ [HCo(CN)5NO]2- + OH-.The IR-spectra of both potassium compounds have been taken.
    Notes: Es wird gezeigt, daß die schon früher beschriebene Umsetzung von schwarzem [Co(NH3)5NO]Cl2 mit wäßriger KCN-Lösung gemäß [Co(NH3)5NO]Cl2 + 5KCN + 3H2O → K2[HCo(CN)5NO]·2H2O + KOH + 5NH3 + 2KCl zu einem gelben, diamagnetischen Dikalium-hydrogennitrosylpentacyanocobaltat(III)-dihydrat führt. Die einkernige Struktur des Anions dieser Verbindung wurde durch salzkryoskopische Messungen nachgewiesen. Durch Umsetzung des Dikaliumsalzes mit konz. wäßriger KOH wird hieraus die kristalline, diamagnetische Trikaliumverbindung K3[Co(CN)5NO] · 2 H2O erhalten; deren wäßrige Lösung ist gemäß [Co(CN)5NO]3- + H2O ⇌ [HCo(CN)5NO]2- + OH- weitgehend protolysiert. Die IR-Spektren beider Verbindungen wurden aufgenommen.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 89
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 309 (1961), S. 297-303 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The purification of silicium by means of transport reactions has been investigated by quantitative analysis. A partly considerable decrease of contamination could be obtained. Furthermore an apparatus is described allowing the purification of silicium on a simple manner. Hereby the silicium powder is treated a t a temperature of 1150°C in a whirl zone with iodine vapour of given pressure.
    Notes: Die Reinigung von Silicium nach den von H. SCHÄFER näher untersuchten Transportreaktionen wurde quantitativ-analytisch verfolgt. Eine teilweise beachtliche Abnahme der Menge der Verunreinigungen konnte festgestellt werden. Außerdem wird eine Apparatur beschrieben, mit der eine Siliciumreinigung auf einfache Weise vorgenommen werden kann. Hierbei wird Siliciumpulver bei 1150°C in einer Wirbelschicht mit Joddampf bestimmten Drucks behandelt.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 90
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 309 (1961), S. 304-314 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Infrared spectra of HPO3NH3 and, completing former investigations, of some salts arc recorded and assigned to the normal vibrations. Calculations of force constants fail to be decisive. It is shown by reference frequencies, that in HPO3NH3 and PO3NH3- the PN-bond is weaker, but in PO3NH22 stronger then a normal single bond.
    Notes: In Ergänzung früherer Untersuchungen werden die Infrarotspektren von HPO3NH3 und von einigen Salzen aufgenommen und den Normalschwingungen zugeordnet. Kraftkonstantenberechnungen verlaufen nicht ganz eindeutig. Durch Frequenzvergleiche wird gezeigt, daß bei den Verbindungen HPO3NH3 und PO3NH3- die PN-Bindung schwächer, bei PO3NH22 aber durch Doppelbindungsanteile stärker als eine normale Einfachbindung ist.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 91
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 92
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 93
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 50-52 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: IR- and proton resonance spectra have shown that the compound 2 MoO3 · P2O5 · 3 H2O has the structure (MoO2)(HPO4) · H2O.
    Notes: Aus Ultrarot- und Protonenresonanzspektren wird für die in der Literatur beschriebene Verbindung 2 MoO3 · P2O5 · 3 H2O die Struktur (MoO2)(HPO4) · H2O abgeleitet.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 94
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 60-69 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By interaction between S4N4 and KCN a derivative of dicyandiamide, K2(C2N10S6) · 2 KSCN, is formed. Triphenyl phosphine and triphenyl phosphine methylene react with S4N4 yielding S3N4P(C6H5)3.The reactions of these intensively red solid reaction products are described and their structural formulae elucidated.
    Notes: Bei der Einwirkung von KCN auf S4N4 entsteht ein Derivat des Dicyandiamids von der Zusammensetzung K2(C2N10S6) · 2 KSCN. Triphenylphosphin und Triphenylphosphinmethylen reagieren mit S4N4 unter Bildung von S3N4P(C6H5)3. Die Reaktionen der intensiv roten Festkörper werden beschrieben und Strukturformeln werden wahrscheinlich gemacht.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 95
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 80-86 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Titanium dibromide is prepared from the elements by a new method in a purity of 99%. The apparatus used is described. The X-ray diagram of the compound is indexed hexagonally with the lattice parameters a = 3,629 Å and c = 6,492 Å. By calculating the intensities, the cadmium iodide structure is secured for TiBr2.
    Notes: Titandibromid wird auf einem neuen Wege aus den Elementen dargestellt und in 99proz. Reinheit isoliert. Die verwendete Apparatur wird beschrieben. Das Röntgendiagramm der Verbindung kann mit den Gitterkonstanten a = 3,629 Å und c = 6,492 Å hexagonal indiziert werden. Durch Berechnung der Intensitäten wird für TiBr2 Cadmiumjodidstruktur sichergestellt.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 96
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 99-109 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Ba2ZnS3, hitherto unknown, was prepared and investigated. The orthorhombic unit cell (D162h-Pnam; a = 12.05, b = 12.65, c = 4.21 Å) contains 4 formula units (dX = 4,52; dpyk = 4.50 g · cm-3). The crystal structure has been determined by Patterson and Fourier syntheses. For the (h k 0)-reflexes the residual factor decreases with the last refinement to R = 0.059, R′ = 0.062 (CuKα). Zn—S-tetrahedra chains along [0 0 1] are connected by Ba2+. Each Ba2+ is surrounded by 7 S-neighbours. Ba2ZnS3 is isotypic to K2CuCl3.
    Notes: Die bislang unbekannte Verbindung Ba2ZnS3 wurde dargestellt und untersucht. Ba2ZnS3 ist farblos. Es kristallisiert orthorhombisch (D162h-Pnam) mit a = 12,05, b = 12,65, c = 4,21 Å. Die Elementarzelle enthält 4 Formeleinheiten (dRö = 4,52, dpyk = 4,50 g · cm-3). Die Kristallstruktur wurde unter Verwendung von PATTERSON- und FOURIER-Synthesen nach [0 0 1] bestimmt. Im CuKα-Bereich ist für die Reflexe (h k 0) R = 0,059, R′ = 0,062. Zn—S-Tetraederketten längs [0 0 1] werden durch Ba2+-Teilchen miteinander verknüpft. Dabei ist jedes Ba2+ von 7 S umgeben. Ba2ZnS3 ist mit K2CuCl3 isotyp
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 97
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961), S. 313-324 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Treatment of the potassium salts of the P4—P4 acid with acetic anhydride yields salts of the cyclic (—P4—P4—O—)2 acid, which is the anhydride of 2 molecules of the P4—P4 acid. Alkaline hydrolysis opens the ring to form the linear P4—P4—O—P4—P4 acid.
    Notes: Durch Behandlung von Kaliumsalzen der P4—P4-Säure mit Essigsäureanhydrid werden Salze der (—P4—P4—O—)2)-Ringsäure gewonnen, die das Anhydrid aus zwei Molekeln P4—P4-Säure ist. Alkalische Hydrolyse öffnet den Ring zur linearen P4—P4—O—P4—P4-Säure.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 98
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961), S. 325-330 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Gaschromatographic investigations of the products of the pyrolysis of Si(CH3)4 led to the isolation of the compound Si2C6H16 (structural formula: (CH3)2Si=CH—Si(CH3)3 (I); b. p. 745 = 122.8 °C; nD20,3 = 1.4430).(I) reacts with bromine to give (CH3)2BrSi—CHBr—Si(CH3)3 and with HBr to give (CH3)2BrSi—CH2—Si(CH3)3. Thus HBr, formed by the bromination of a mixture of (I) and (CH3)2HSi—CH2—Si(CH3)3, is added by surplus (I).
    Notes: In den destillierbaren Pyrolyseprodukten des Si(CH3)4 wurde bei der gaschromatographischen Untersuchung die Verbindung Si2C6H16 mit der Strukturformel (CH3)2Si=CH—Si(CH3)3 (I) aufgefunden; Sdp745 = 122,8 °C; nD20,3 = 1,4430.(I) bildet mit Brom (CH3)2BrSi—CHBr—Si(CH3)3 und reagiert mit HBr zu (CH3)2BrSi—CH2—Si(CH3)3. Die Addition von HBr erfolgt so leicht, daß bei Bromierung eines Gemisches auf (I) und (CH3)2HSi—CH2—Si(CH3)3 der aus der Si—H-Gruppe entstehende HBr an (I) angelagert wird.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 99
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961), S. 345-348 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: It is shown that the formation of silver ferrite(III) from iron(III) oxidehydrates is independent from the particle size of the iron compounds.The cold-working of iron(III) oxidehydrates, their interaction with H2S, and the formation of magnetite are discussed.
    Notes: Es wird gezeigt, daß die Silberferritbildung von der Teilchengröße der Eisen(III)-hydroxyde nicht abhängig ist. Ferner wird in diesem Zusammenhang deren Kaltbearbeitung, die Magnetitbildung sowie die H2S-Einwirkung auf die letzteren kurz besprochen.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
  • 100
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Library Location Call Number Volume/Issue/Year Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...